BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001024-TA|BGIBMGA001024-PA|IPR013026|Tetratricopeptide region, IPR008940|Protein prenyltransferase, IPR013618|Domain of unknown function DUF1736, IPR001440|Tetratricopeptide TPR_1, IPR013105|Tetratricopeptide TPR_2 (744 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 27 0.73 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 25 2.2 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 26.6 bits (56), Expect = 0.73 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 454 RGDILIKLNRTKEAQEVYERALLYDSGNPDIYYNLGV 490 RG + +N+ Q V LLY + D++YN V Sbjct: 91 RGQVFTMMNKEMRHQAVVLFRLLYSAKTFDVFYNTAV 127 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 25.0 bits (52), Expect = 2.2 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 501 ALAYLDKALELEPEHEQALLNSAILLQELGAADLRHLARQRLLKLLDKDATNERVHFNLG 560 A+AY+ ELEPE + + QE G+ ++ + LD D +RV+ G Sbjct: 11 AVAYVSAQAELEPEDTMDYIPTRFRRQERGSIVIQGTKEGKSRPSLDID-YKQRVYDKNG 69 Query: 561 M 561 M Sbjct: 70 M 70 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.135 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,756 Number of Sequences: 429 Number of extensions: 5944 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 2 length of query: 744 length of database: 140,377 effective HSP length: 63 effective length of query: 681 effective length of database: 113,350 effective search space: 77191350 effective search space used: 77191350 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -