SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001023-TA|BGIBMGA001023-PA|undefined
         (128 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1176 + 35142024-35142123,35143192-35143199,35143788-351439...    28   2.7  

>01_06_1176 +
          35142024-35142123,35143192-35143199,35143788-35143910,
          35145454-35145732,35145965-35146081
          Length = 208

 Score = 27.9 bits (59), Expect = 2.7
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 46 LGAVIILACVLVYHNCLYCGFVFDDISAIKENRDLRPQTPISNIFLN 92
          + +V I+ C     + L  GFVF+ +  + EN+DL P+T I    LN
Sbjct: 13 VSSVSIVVCNKALMSTL--GFVFEILMKLFENKDLDPKTIIGFGILN 57


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.325    0.144    0.456 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,376,288
Number of Sequences: 37544
Number of extensions: 120161
Number of successful extensions: 221
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 220
Number of HSP's gapped (non-prelim): 1
length of query: 128
length of database: 14,793,348
effective HSP length: 74
effective length of query: 54
effective length of database: 12,015,092
effective search space: 648814968
effective search space used: 648814968
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.5 bits)
S2: 55 (26.2 bits)

- SilkBase 1999-2023 -