BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001020-TA|BGIBMGA001020-PA|IPR009003|Peptidase, trypsin-like serine and cysteine, IPR001254|Peptidase S1 and S6, chymotrypsin/Hap (145 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 28 0.034 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 5.2 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 28.3 bits (60), Expect = 0.034 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Query: 92 GWGATSGDSGGPAVKGN------VQLGVVSFGVGCARKNNPGIYAKVSAAAKWIKS 141 G A DSGGP + N V +G++S+G C + N KV + WI S Sbjct: 341 GKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAECGKYPNGN--TKVGSYIDWIVS 394 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.0 bits (42), Expect = 5.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 80 SSVPDKTKLLVSGWGATSGDS 100 SSVP + L + ++SGDS Sbjct: 54 SSVPQPPRSLEGSYDSSSGDS 74 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.309 0.127 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,344 Number of Sequences: 429 Number of extensions: 1509 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 145 length of database: 140,377 effective HSP length: 52 effective length of query: 93 effective length of database: 118,069 effective search space: 10980417 effective search space used: 10980417 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.8 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -