BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001016-TA|BGIBMGA001016-PA|undefined (154 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00064-2|AAD31934.2| 329|Caenorhabditis elegans Hypothetical pr... 27 5.9 Z68880-1|CAA93098.1| 652|Caenorhabditis elegans Hypothetical pr... 27 7.8 >U00064-2|AAD31934.2| 329|Caenorhabditis elegans Hypothetical protein ZC155.7 protein. Length = 329 Score = 27.1 bits (57), Expect = 5.9 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Query: 82 TLIELLKQSSGVNSDEEVLRIREAKLRVIAERVGLRRLHVLAPRLRSLILDGSALSSLRD 141 T I + + +N+D EV RE + V+A +R L+ L L +I+D ++ D Sbjct: 221 TEISMAQLQQFMNNDREV---REREKEVMAVNTSIRELNTLFQDLSEMIVDQGSVIDRID 277 Query: 142 LGIGLVHLKV 151 + ++V Sbjct: 278 YNVEQTSIRV 287 >Z68880-1|CAA93098.1| 652|Caenorhabditis elegans Hypothetical protein T14G10.1 protein. Length = 652 Score = 26.6 bits (56), Expect = 7.8 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Query: 69 LPGYRRIVIPRELTLIELLKQSSGVNSDEEVLRIREAKLRVIAE 112 +P R + + +LT+ ELLK+S + + E+ ++ L+V+AE Sbjct: 237 VPAVRELFVSDDLTVAELLKESQNLPT-VELTKVDLQWLQVLAE 279 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.325 0.142 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,171,262 Number of Sequences: 27539 Number of extensions: 58643 Number of successful extensions: 177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 177 Number of HSP's gapped (non-prelim): 2 length of query: 154 length of database: 12,573,161 effective HSP length: 76 effective length of query: 78 effective length of database: 10,480,197 effective search space: 817455366 effective search space used: 817455366 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -