BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001014-TA|BGIBMGA001014-PA|IPR005178|Protein of unknown function DUF300 (421 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 4.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 5.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 7.1 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/34 (26%), Positives = 18/34 (52%) Query: 105 EFPEQSIYLDSLRECYEAYVIYNFMKYLLNYLND 138 +FP Y SL +CY ++ + +++ +L D Sbjct: 32 DFPTNQKYYPSLAKCYACLLMVVKILWVIYWLQD 65 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.6 bits (46), Expect = 5.4 Identities = 8/30 (26%), Positives = 17/30 (56%) Query: 256 VVFFSFFQGVIITILVYCGVLKTIFDISDT 285 ++F F +II +++YC + K + + T Sbjct: 241 IIFLFFIIPLIILLILYCIIAKNLMSNAAT 270 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 7.1 Identities = 13/56 (23%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 364 PSSSAPNLTTETETP-SVEVRPSAYGSIENTVTNMSMTSETEPLLDASDKSNDNEN 418 PS+S ++ +P SV P + T N+S + + +++K+ N N Sbjct: 132 PSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASSTSSTSSTEKAGTNNN 187 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.137 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,188 Number of Sequences: 317 Number of extensions: 4153 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 3 length of query: 421 length of database: 114,650 effective HSP length: 59 effective length of query: 362 effective length of database: 95,947 effective search space: 34732814 effective search space used: 34732814 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -