BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001013-TA|BGIBMGA001013-PA|IPR002290|Serine/threonine protein kinase, IPR000719|Protein kinase, IPR008271|Serine/threonine protein kinase, active site, IPR001245|Tyrosine protein kinase, IPR011009|Protein kinase-like (360 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 56 3e-10 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 56.4 bits (130), Expect = 3e-10 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 5/93 (5%) Query: 132 RQIISGLQYIHTMNIAHRDLKCENVLVTANYNVKITDFGFARNVRQRDRDVLSETYCGSL 191 RQ+ G++++ + HRDL NVLV N+ VK++DFG +R+V Q +V + G L Sbjct: 599 RQVALGMEHLAKTRVVHRDLAARNVLVCENHTVKVSDFGLSRDVYQ--DNVYCKNGGGKL 656 Query: 192 --SYAAPEVLKGVPYMPKLADMWSIGVILYTML 222 + A E L Y +D+WS GV+L+ ++ Sbjct: 657 PVRWMALESLTHQRY-TTYSDVWSFGVLLWEIV 688 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,933 Number of Sequences: 317 Number of extensions: 3252 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 360 length of database: 114,650 effective HSP length: 58 effective length of query: 302 effective length of database: 96,264 effective search space: 29071728 effective search space used: 29071728 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -