BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001006-TA|BGIBMGA001006-PA|undefined (86 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK131415-1|BAD18562.1| 803|Homo sapiens protein ( Homo sapiens ... 27 7.0 >AK131415-1|BAD18562.1| 803|Homo sapiens protein ( Homo sapiens cDNA FLJ16525 fis, clone OCBBF2005433, weakly similar to N-CHIMAERIN. ). Length = 803 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Query: 11 LPRKSSGRTQT---SPSYAA--ERNPSNLPVRERNFSPDRSSVTLGPRP 54 LPRK T SPS + PS + + N P+ S+ T GP+P Sbjct: 214 LPRKMCRSVSTDNLSPSLLKPFQEGPSGRSLSQENLPPEASASTAGPQP 262 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.319 0.132 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,494,998 Number of Sequences: 224733 Number of extensions: 391088 Number of successful extensions: 1254 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1254 Number of HSP's gapped (non-prelim): 1 length of query: 86 length of database: 73,234,838 effective HSP length: 64 effective length of query: 22 effective length of database: 58,851,926 effective search space: 1294742372 effective search space used: 1294742372 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -