GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001006-TA|BGIBMGA001006-PA|undefined
         (86 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK131415-1|BAD18562.1|  803|Homo sapiens protein ( Homo sapiens ...    27   7.0  

>AK131415-1|BAD18562.1|  803|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16525 fis, clone OCBBF2005433, weakly  similar
           to N-CHIMAERIN. ).
          Length = 803

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 5/49 (10%)

Query: 11  LPRKSSGRTQT---SPSYAA--ERNPSNLPVRERNFSPDRSSVTLGPRP 54
           LPRK      T   SPS     +  PS   + + N  P+ S+ T GP+P
Sbjct: 214 LPRKMCRSVSTDNLSPSLLKPFQEGPSGRSLSQENLPPEASASTAGPQP 262


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.319    0.132    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,494,998
Number of Sequences: 224733
Number of extensions: 391088
Number of successful extensions: 1254
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1254
Number of HSP's gapped (non-prelim): 1
length of query: 86
length of database: 73,234,838
effective HSP length: 64
effective length of query: 22
effective length of database: 58,851,926
effective search space: 1294742372
effective search space used: 1294742372
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 57 (27.1 bits)