BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001002-TA|BGIBMGA001002-PA|IPR001092|Basic helix-loop-helix dimerisation region bHLH, IPR011598|Helix-loop-helix DNA-binding (404 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1196 + 28316186-28316290,28317529-28317633,28317725-283177... 30 2.9 04_03_0272 + 13725262-13725443,13726036-13726114,13726329-137263... 30 2.9 01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-53... 30 2.9 05_01_0511 + 4256220-4256828,4256920-4257175,4257247-4257309,425... 30 3.8 11_04_0460 - 17955102-17955146,17955253-17955310,17955442-179555... 29 6.6 08_02_1162 - 24811327-24812162,24815969-24816028,24816526-248167... 29 6.6 12_02_0356 + 17915029-17916236,17932970-17933283,17933936-179342... 29 8.8 11_03_0064 + 9518810-9519164,9519533-9520359 29 8.8 10_07_0179 - 13860745-13861571,13861940-13862294 29 8.8 09_01_0073 - 1057560-1058043,1058199-1058385,1058754-1059062,105... 29 8.8 04_03_0961 + 21263735-21263773,21264157-21264279,21266774-212668... 29 8.8 04_03_0647 + 18367321-18367675,18368044-18368885 29 8.8 02_04_0515 + 23582105-23583519,23583613-23583741,23583835-235839... 29 8.8 02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196 29 8.8 01_06_1783 + 39845998-39846174,39846260-39846534,39846758-398468... 29 8.8 01_06_0392 + 28964006-28964204,28964496-28964977,28965075-28965176 29 8.8 >06_03_1196 + 28316186-28316290,28317529-28317633,28317725-28317796, 28318023-28318259,28318608-28318718,28318810-28318923, 28319272-28319373,28320238-28320306,28320447-28320553, 28321128-28321224,28321347-28321466,28321663-28321847, 28322065-28322353 Length = 570 Score = 30.3 bits (65), Expect = 2.9 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Query: 283 EHFSVIPE--QNYLSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFALNPDLILPE 340 E++S++ NY S+ + + + D SL+ H++ N + D+ +++N I P Sbjct: 482 EYWSMVKTTYNNYNSDVDDELVDLDAPEMNVGSLDDHVEIDLNSDDDLEYSMNKMSITPN 541 Query: 341 NQFKFKESDNS 351 F + NS Sbjct: 542 RSFFHQIMANS 552 >04_03_0272 + 13725262-13725443,13726036-13726114,13726329-13726390, 13726575-13726700,13726780-13726879,13727143-13727226, 13727328-13727462 Length = 255 Score = 30.3 bits (65), Expect = 2.9 Identities = 19/70 (27%), Positives = 33/70 (47%) Query: 11 NASVNKAQILQETVNNSLNITNNDPNQNVRREIIVLRKKQRIQPADTVSVPALMRTIEPS 70 N +V Q+LQ V SL+ N V++E LRKK I + + + + E + Sbjct: 159 NFTVRDLQLLQNQVEMSLHSIRNKKGSLVQKENSELRKKFNIAHQRNIELHKKLNSGEST 218 Query: 71 SSSVLAKKAR 80 SS + + ++ Sbjct: 219 SSEQVTRSSK 228 >01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-539241, 539345-539595,539678-539798,539893-540133,540341-540445, 540571-540615,540738-540890,541132-541410,541705-541841, 541975-542017,542228-542329 Length = 835 Score = 30.3 bits (65), Expect = 2.9 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Query: 224 LRQQQYVDIAASENFHLVSTPHLYDEEEGQPLTPSSDLLVQDEVNSHILDAHFQFPNSAE 283 L++ Q+ D + STPH + +++ PSS L + H L A F N+A+ Sbjct: 30 LKRMQH-DYSPQGTIITTSTPHDHHQQQQSVAAPSSYNLSHCRLLLHKLPAAFFGSNNAD 88 Query: 284 HFSVIPEQNYLSETEVPVSE 303 H I + + EV +E Sbjct: 89 HAGAIQVRRRVGRGEVYETE 108 >05_01_0511 + 4256220-4256828,4256920-4257175,4257247-4257309, 4257397-4257491 Length = 340 Score = 29.9 bits (64), Expect = 3.8 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 7/74 (9%) Query: 328 IPFALNPDLILPENQFKFKESDNSSFTENEDFCEVE---LKKELPDIQVTPEDREQFEET 384 +PF D P Q + D S NE E + + +E+ D P E ++ Sbjct: 106 VPFVHPKD---PSVQMNMDDGDGPSAEVNETSVEEDWLLVTEEVVDHAREPHTEEAYQAY 162 Query: 385 LKWWQEKTRQTRPT 398 L+W+Q +TR TR T Sbjct: 163 LRWYQPRTR-TRVT 175 >11_04_0460 - 17955102-17955146,17955253-17955310,17955442-17955593, 17955888-17955993,17956101-17956222,17956766-17956834, 17956969-17957214,17957331-17957373,17957449-17957520, 17957954-17958066,17958158-17958238,17958343-17958415, 17959413-17959519,17960410-17960514,17960684-17960974, 17961621-17961707,17961774-17961842,17961917-17961973, 17962057-17962155,17962223-17962312,17962395-17962511, 17964164-17964244,17964353-17964502,17964812-17964956, 17967359-17967510,17967647-17967784,17967838-17967914, 17968032-17968134 Length = 1015 Score = 29.1 bits (62), Expect = 6.6 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 2/87 (2%) Query: 287 VIPEQNYLSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFAL-NPDLILPENQFKF 345 VI Q Y V + FE + N HI + AL N D+ ++ KF Sbjct: 894 VIMIQRYKEVLVYSVLLAKFEPSQSGKANTHIMHGASHFLQCVHALWNRDITYDLSK-KF 952 Query: 346 KESDNSSFTENEDFCEVELKKELPDIQ 372 ++ E E F E+E+++ L DI+ Sbjct: 953 AKAKRLGIDEEEGFQEIEMRQWLQDIR 979 >08_02_1162 - 24811327-24812162,24815969-24816028,24816526-24816725, 24817436-24817657,24817989-24818312,24818852-24818988 Length = 592 Score = 29.1 bits (62), Expect = 6.6 Identities = 13/47 (27%), Positives = 24/47 (51%) Query: 277 QFPNSAEHFSVIPEQNYLSETEVPVSESDFEIKYADSLNQHIQQSFN 323 + P A+ S E + + +PV ESD +++ S+ H+ S+N Sbjct: 190 ELPIDADSQSGCDESPHRTVFVLPVGESDIYVRFPTSIRHHMDGSYN 236 >12_02_0356 + 17915029-17916236,17932970-17933283,17933936-17934244, 17934613-17935439 Length = 885 Score = 28.7 bits (61), Expect = 8.8 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 294 LSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFALNPD---LILPENQFKFKESDN 350 L E+P+ ES F I+ D+ Q +++S N F D I P N +KFK D+ Sbjct: 589 LKPLELPLEESYFIIE-TDASQQGMKRSMNYAGVECFTFGDDNKLRIFPPNSYKFKPKDH 647 Query: 351 SSFTENED 358 E ++ Sbjct: 648 IILDEVQE 655 >11_03_0064 + 9518810-9519164,9519533-9520359 Length = 393 Score = 28.7 bits (61), Expect = 8.8 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 294 LSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFALNPD---LILPENQFKFKESDN 350 L E+P+ ES F I+ D+ Q +++S N F D I P N +KFK D+ Sbjct: 97 LKPLELPLEESYFIIE-TDASQQGMKRSMNYAGVECFTFGDDNKLRIFPPNSYKFKPKDH 155 Query: 351 SSFTENED 358 E ++ Sbjct: 156 IILDEVQE 163 >10_07_0179 - 13860745-13861571,13861940-13862294 Length = 393 Score = 28.7 bits (61), Expect = 8.8 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 294 LSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFALNPD---LILPENQFKFKESDN 350 L E+P+ ES F I+ D+ Q +++S N F D I P N +KFK D+ Sbjct: 97 LKPLELPLEESYFIIE-TDASQQGMKRSMNYAGVECFTFGDDNKLRIFPPNSYKFKPKDH 155 Query: 351 SSFTENED 358 E ++ Sbjct: 156 IILDEVQE 163 >09_01_0073 - 1057560-1058043,1058199-1058385,1058754-1059062, 1059427-1060269,1061572-1062552,1063189-1063516 Length = 1043 Score = 28.7 bits (61), Expect = 8.8 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 294 LSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFALNPD---LILPENQFKFKESDN 350 L E+P+ ES F I+ D+ Q +++S N F D I P N +KFK D+ Sbjct: 799 LKPLELPLEESYFIIE-TDASQQGMKRSMNYAGVECFTFGDDNKLRIFPPNSYKFKPKDH 857 Query: 351 SSFTENED 358 E ++ Sbjct: 858 IILDEVQE 865 >04_03_0961 + 21263735-21263773,21264157-21264279,21266774-21266847, 21266939-21267095,21267554-21267694,21267739-21267823, 21268810-21268903,21269041-21269239,21269515-21269549, 21270076-21270631,21270722-21270882,21271704-21271718, 21273078-21273330,21273439-21273562,21273688-21273788, 21274870-21274938,21275060-21275191,21275270-21275404, 21275489-21275551,21275636-21275881,21276007-21276285 Length = 1026 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 223 GLRQQQYVDIAASENFHLVSTPHLYDEEEGQPLTPSSDLLVQDEVNS 269 G ++ Y+ + F + + P LYD + +P + D+L++DE N+ Sbjct: 302 GFQEATYLWEDDDDRFSVENVP-LYDSADDEPTSIPKDILIKDEPNT 347 >04_03_0647 + 18367321-18367675,18368044-18368885 Length = 398 Score = 28.7 bits (61), Expect = 8.8 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 294 LSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFALNPD---LILPENQFKFKESDN 350 L E+P+ ES F I+ D+ Q +++S N F D I P N +KFK D+ Sbjct: 97 LKPLELPLDESYFIIE-TDASQQGMKRSMNYAGVECFTFGDDNKLRIFPPNSYKFKPKDH 155 Query: 351 SSFTENED 358 E ++ Sbjct: 156 IILDEVQE 163 >02_04_0515 + 23582105-23583519,23583613-23583741,23583835-23583970, 23584051-23584139,23584236-23584347,23584427-23584533, 23584630-23584723 Length = 693 Score = 28.7 bits (61), Expect = 8.8 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 1/82 (1%) Query: 10 RNASVNKAQILQETVNNSLNITNNDPNQNVRREIIVLRKKQRIQPADTVSVPALMRTIEP 69 +N V++ + T+ N L D + V +KK+ + P D++ + + P Sbjct: 200 KNRIVDEEEEGYPTMRNILTSRWADAGDE-EENVFVPKKKKSVSPVDSIERGSTKKVTSP 258 Query: 70 SSSSVLAKKARYRENTSSDETV 91 S VL + + SSD V Sbjct: 259 ESGEVLVYNSVRSSSRSSDSGV 280 >02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196 Length = 933 Score = 28.7 bits (61), Expect = 8.8 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 294 LSETEVPVSESDFEIKYADSLNQHIQQSFNENTDIPFALNPD---LILPENQFKFKESDN 350 L E+P+ ES F I+ D+ Q +++S N F D I P N +KFK D+ Sbjct: 637 LKPLELPLEESYFIIE-TDASQQGMKRSMNYAGVECFTFGDDNKLRIFPPNSYKFKPKDH 695 Query: 351 SSFTENED 358 E ++ Sbjct: 696 IILDEVQE 703 >01_06_1783 + 39845998-39846174,39846260-39846534,39846758-39846891, 39846992-39847116,39847312-39847494,39847610-39847644, 39847756-39847912,39847936-39848049,39848143-39848235, 39848316-39848455,39848606-39848676,39848759-39848839, 39851475-39851954,39852110-39852387,39853346-39854143 Length = 1046 Score = 28.7 bits (61), Expect = 8.8 Identities = 10/23 (43%), Positives = 17/23 (73%) Query: 182 SFPSPASSSPRENSQERSYFMIS 204 +FP+P+SSSPR + +Y ++S Sbjct: 2 AFPAPSSSSPRRRGRGLAYLLVS 24 >01_06_0392 + 28964006-28964204,28964496-28964977,28965075-28965176 Length = 260 Score = 28.7 bits (61), Expect = 8.8 Identities = 33/155 (21%), Positives = 57/155 (36%), Gaps = 12/155 (7%) Query: 160 NLESLLNIGHADKENTSRSCMESFPSPASSSPRENSQERSYFMISSPAXXXXXXXXXXID 219 +L S N+ H D S E +P +++ + +ER P +D Sbjct: 57 HLPSRPNVPHVDVSEDSMESSEEMVTPRAAASEADEEERKAATSEVPVEVVEAGEEVMVD 116 Query: 220 GLP-----GLRQQQYVDIAASENFHLVSTPHLYDEEEGQPLTPSSDLLVQDEVNSHILDA 274 LP G ++QQ +E +V P + EE + P D Q E +L Sbjct: 117 ALPPEAAAGAQEQQ----GKAEALVVVQEPEVKREELVAKVHPMHDPEPQGE---EVLIV 169 Query: 275 HFQFPNSAEHFSVIPEQNYLSETEVPVSESDFEIK 309 ++ + V ++ + ET P + + E K Sbjct: 170 EAAAVSAVQEPEVKRDEVVVMETAAPPAVQESETK 204 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.311 0.127 0.351 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,655,509 Number of Sequences: 37544 Number of extensions: 430291 Number of successful extensions: 933 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 927 Number of HSP's gapped (non-prelim): 17 length of query: 404 length of database: 14,793,348 effective HSP length: 84 effective length of query: 320 effective length of database: 11,639,652 effective search space: 3724688640 effective search space used: 3724688640 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -