BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001001-TA|BGIBMGA001001-PA|IPR001092|Basic helix-loop-helix dimerisation region bHLH, IPR011598|Helix-loop-helix DNA-binding (193 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0864 + 6567619-6567729,6567984-6568136 30 1.4 02_05_0745 - 31442980-31443135,31443362-31443472 28 4.2 05_01_0437 + 3471154-3471447,3471664-3471858,3472619-3472741,347... 27 7.4 03_01_0451 + 3461229-3461561,3462043-3462290,3462425-3462716,346... 27 7.4 03_01_0232 + 1824517-1825506 27 7.4 12_01_0026 + 219663-220843,222201-222447,222574-224535 27 9.8 02_01_0745 - 5550472-5551053 27 9.8 >06_01_0864 + 6567619-6567729,6567984-6568136 Length = 87 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 93 RGSSRKLSKVDTLRLAVEYIKSLKRLLDESDDGCSDTQLGLGLSTTGSQ 141 R + + S L+ YIKSL R +D+ D SD G+ ++ G++ Sbjct: 32 RRGANQASTTKLLKETCSYIKSLHREVDDLSDRLSDLMAGMDHNSPGAE 80 >02_05_0745 - 31442980-31443135,31443362-31443472 Length = 88 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 93 RGSSRKLSKVDTLRLAVEYIKSLKRLLDESDDGCSDTQLGLGLSTTGSQ 141 RGSS+ S L+ YIKSL R +D+ D SD + ++ G++ Sbjct: 33 RGSSQA-STTKLLKETCNYIKSLHREVDDLSDRLSDLMATMDHNSPGAE 80 >05_01_0437 + 3471154-3471447,3471664-3471858,3472619-3472741, 3473245-3473430,3473633-3473766,3473866-3474052, 3474179-3474280 Length = 406 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/39 (38%), Positives = 20/39 (51%) Query: 83 SAVTAALAGGRGSSRKLSKVDTLRLAVEYIKSLKRLLDE 121 S+ AA GG G S + VD L V + LKR ++E Sbjct: 63 SSAAAAPGGGGGGSGDAAAVDHLTSLVSRLHGLKRKMEE 101 >03_01_0451 + 3461229-3461561,3462043-3462290,3462425-3462716, 3463057-3463209,3463288-3463674 Length = 470 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Query: 21 LQTPAPRRLAPAPVDTTRCKKRSYLHQPYP 50 LQT PR + P P+ R + LH+P P Sbjct: 3 LQTLNPRHVLPLPLPRRRAPRPRVLHRPPP 32 >03_01_0232 + 1824517-1825506 Length = 329 Score = 27.5 bits (58), Expect = 7.4 Identities = 20/90 (22%), Positives = 32/90 (35%) Query: 75 AALRQHIPSAVTAALAGGRGSSRKLSKVDTLRLAVEYIKSLKRLLDESDDGCSDTQLGLG 134 AALR+ + + AAL R S R LS++ + + Y S +S + +G Sbjct: 143 AALRRRDATRLAAALRARRRSDRDLSRLASTLRDLSYRSSSAAATSDSGEAALAEAVGAA 202 Query: 135 LSTTGSQTXXXXXXXXXXXXXFVSESSAGP 164 + + S S A P Sbjct: 203 TCAAAAASASFFAGLASASASSASRSLASP 232 >12_01_0026 + 219663-220843,222201-222447,222574-224535 Length = 1129 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/40 (40%), Positives = 20/40 (50%) Query: 79 QHIPSAVTAALAGGRGSSRKLSKVDTLRLAVEYIKSLKRL 118 +H + + A+L G S RKLS D E SLKRL Sbjct: 928 RHFLTKIQASLCSGSISKRKLSMSDDQEKLQESPSSLKRL 967 >02_01_0745 - 5550472-5551053 Length = 193 Score = 27.1 bits (57), Expect = 9.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 168 DVYDAYEPMSPEDEELLDV 186 +VYD Y PMSP ++++D+ Sbjct: 46 EVYDPYGPMSPPSQKVVDL 64 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.314 0.129 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,497,636 Number of Sequences: 37544 Number of extensions: 202353 Number of successful extensions: 430 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 423 Number of HSP's gapped (non-prelim): 7 length of query: 193 length of database: 14,793,348 effective HSP length: 78 effective length of query: 115 effective length of database: 11,864,916 effective search space: 1364465340 effective search space used: 1364465340 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -