SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001001-TA|BGIBMGA001001-PA|IPR001092|Basic
helix-loop-helix dimerisation region bHLH, IPR011598|Helix-loop-helix
DNA-binding
         (193 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g25130.1 68415.m03006 armadillo/beta-catenin repeat family pr...    27   6.2  

>At2g25130.1 68415.m03006 armadillo/beta-catenin repeat family
           protein contains Pfam profile: PF00514
           armadillo/beta-catenin-like repeat
          Length = 468

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 71  NNGFAALRQHIPSAVTAALAGGRGSSRKLSKVDTLRLAVEYIKSLKR-LLDESDDGCSDT 129
           NN    +   IPSA +++L+G   S   L ++    ++       +R L +E D+GCS +
Sbjct: 7   NNVDPLILHRIPSASSSSLSGNTFSGSSLRRIIFDAISCGGSSRYRRELREEDDEGCSKS 66

Query: 130 QL 131
            +
Sbjct: 67  TI 68


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.314    0.129    0.384 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,183,058
Number of Sequences: 28952
Number of extensions: 144380
Number of successful extensions: 308
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 308
Number of HSP's gapped (non-prelim): 1
length of query: 193
length of database: 12,070,560
effective HSP length: 77
effective length of query: 116
effective length of database: 9,841,256
effective search space: 1141585696
effective search space used: 1141585696
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 57 (27.1 bits)

- SilkBase 1999-2023 -