BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000998-TA|BGIBMGA000998-PA|undefined
(124 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 20 8.0
>DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory
protein 14 protein.
Length = 126
Score = 19.8 bits (39), Expect = 8.0
Identities = 10/33 (30%), Positives = 18/33 (54%)
Query: 32 NEPFNWRGMGYLGNPCPESEDVCVKLIERKGAQ 64
N+P W+ + +P E + KL+E++G Q
Sbjct: 93 NKPNWWQELEAKFDPKGEYKQKYNKLLEKEGLQ 125
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.322 0.138 0.440
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,099
Number of Sequences: 317
Number of extensions: 1227
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 124
length of database: 114,650
effective HSP length: 50
effective length of query: 74
effective length of database: 98,800
effective search space: 7311200
effective search space used: 7311200
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.0 bits)
S2: 39 (19.8 bits)
- SilkBase 1999-2023 -