Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000996-TA|BGIBMGA000996-PA|undefined
         (127 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    20   9.8  

>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 19.8 bits (39), Expect = 9.8
 Identities = 11/39 (28%), Positives = 14/39 (35%)

Query: 34  GELGSCGDPLPFNISDPEAEHGVHITACPSGWCAKRIQG 72
           GEL      + F +  PE    V    C  G   K + G
Sbjct: 564 GELRLNMSAIQFKLGHPEPPESVCSLPCEVGQAKKYVAG 602


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.138    0.458 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 40,772
Number of Sequences: 429
Number of extensions: 1526
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 127
length of database: 140,377
effective HSP length: 51
effective length of query: 76
effective length of database: 118,498
effective search space:  9005848
effective search space used:  9005848
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.1 bits)
S2: 39 (19.8 bits)