BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000996-TA|BGIBMGA000996-PA|undefined
(127 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 20 9.8
>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
receptor protein.
Length = 1040
Score = 19.8 bits (39), Expect = 9.8
Identities = 11/39 (28%), Positives = 14/39 (35%)
Query: 34 GELGSCGDPLPFNISDPEAEHGVHITACPSGWCAKRIQG 72
GEL + F + PE V C G K + G
Sbjct: 564 GELRLNMSAIQFKLGHPEPPESVCSLPCEVGQAKKYVAG 602
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.324 0.138 0.458
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 40,772
Number of Sequences: 429
Number of extensions: 1526
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 127
length of database: 140,377
effective HSP length: 51
effective length of query: 76
effective length of database: 118,498
effective search space: 9005848
effective search space used: 9005848
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.1 bits)
S2: 39 (19.8 bits)
- SilkBase 1999-2023 -