BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000989-TA|BGIBMGA000989-PA|IPR000834|Peptidase M14, carboxypeptidase A (666 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 8.9 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 8.9 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.6 bits (46), Expect = 8.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 40 EIDTDENTFRTIAKLKE 56 E+D D+N FR LK+ Sbjct: 74 ELDVDQNGFRNFTNLKK 90 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.6 bits (46), Expect = 8.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Query: 99 PYYSPSGKELNPQPVGEEAGTVTFQYYPMSAV 130 P Y P+ ++P P AG + Y P+ V Sbjct: 149 PKYEPNPSIIDPGPALPPAGFLCNNYLPLPQV 180 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,968 Number of Sequences: 317 Number of extensions: 7658 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 2 length of query: 666 length of database: 114,650 effective HSP length: 61 effective length of query: 605 effective length of database: 95,313 effective search space: 57664365 effective search space used: 57664365 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -