GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000986-TA|BGIBMGA000986-PA|undefined
         (155 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    21   5.7  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 21.0 bits (42), Expect = 5.7
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 99  MSSYFNLLKEAGTCAVAKMKIIEWKLSHAGWWVKKQQHDFLPCSCPAH 146
           +++ F  L E     V+    I  K   +G+ ++ +Q +FLP   PA+
Sbjct: 613 LANKFESLSEPLRIHVSPTTYILLKYPISGFDLEPRQKEFLPKEFPAN 660


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.320    0.132    0.408 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,756
Number of Sequences: 429
Number of extensions: 1305
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 155
length of database: 140,377
effective HSP length: 53
effective length of query: 102
effective length of database: 117,640
effective search space: 11999280
effective search space used: 11999280
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.4 bits)
S2: 40 (20.2 bits)