GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000985-TA|BGIBMGA000985-PA|undefined
         (261 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    23   2.3  
AF265298-1|AAG17641.1|  124|Tribolium castaneum putative cytochr...    21   7.1  

>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 8/13 (61%), Positives = 10/13 (76%)

Query: 205 LHEPDSDNEDVPS 217
           LH PD+ N D+PS
Sbjct: 132 LHRPDTQNLDLPS 144


>AF265298-1|AAG17641.1|  124|Tribolium castaneum putative cytochrome
           P450 monooxigenase protein.
          Length = 124

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 9/39 (23%), Positives = 20/39 (51%)

Query: 71  LEDLIYDNVQLLTDDDIGIVVDLRQRKDYLEHICDKLQK 109
           +++ +Y+ V  + D+   I +   Q   YLE +  + Q+
Sbjct: 18  VQEKLYEEVAAVIDNIENITMQQLQEMKYLEMVLKEAQR 56


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.136    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 57,165
Number of Sequences: 317
Number of extensions: 2355
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 2
length of query: 261
length of database: 114,650
effective HSP length: 56
effective length of query: 205
effective length of database: 96,898
effective search space: 19864090
effective search space used: 19864090
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 42 (21.0 bits)