BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000981-TA|BGIBMGA000981-PA|IPR003599|Immunoglobulin subtype, IPR002345|Lipocalin, IPR009057|Homeodomain-like, IPR004875|CENP-B protein (1260 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 27 0.61 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 27 1.1 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 26 1.9 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 25 3.3 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 25 3.3 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 24 7.5 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 27.5 bits (58), Expect = 0.61 Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 751 TPEKEEIRREYENRLKRTKAKQVKKRLDGGKT 782 TP+ EE++R + LK + AK K+ G KT Sbjct: 56 TPDGEELKRVLPDALKTSCAKCTDKQKQGAKT 87 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 26.6 bits (56), Expect = 1.1 Identities = 16/56 (28%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 995 QHPNGTQYTPVPRSDDSDDSLFWYAGESLQTGDCGISFSYAT--DEDSGEWTCHMG 1048 Q+PN T Y + DS LFW + +S A D +CH G Sbjct: 86 QYPNPTYYNLADPARDSRKGLFWSPAATAAATATEYKYSAAAPGPSDPSVSSCHQG 141 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 25.8 bits (54), Expect = 1.9 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Query: 254 GYKAHNRVFTREQELELSKYLIRCADIYFGLTKKDVMKLAYELTVKYNL--SRPRTWDDN 311 GY A N+ R + ++ + + FG T+ + + E+ +K NL SR + W N Sbjct: 60 GYPAGNQRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKN 119 Query: 312 GMA 314 A Sbjct: 120 RRA 122 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 25.0 bits (52), Expect = 3.3 Identities = 14/45 (31%), Positives = 20/45 (44%) Query: 620 TPPTSPSILTLEPQEEMEELSNEALLVQQPTENMPQCSQVLDKEQ 664 TP TSP+ ++ PQ S Q P SQV+ K++ Sbjct: 150 TPKTSPNEASMSPQSTSSNNSASPKACQFLYNQFPGSSQVVVKDE 194 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 25.0 bits (52), Expect = 3.3 Identities = 14/45 (31%), Positives = 20/45 (44%) Query: 620 TPPTSPSILTLEPQEEMEELSNEALLVQQPTENMPQCSQVLDKEQ 664 TP TSP+ ++ PQ S Q P SQV+ K++ Sbjct: 170 TPKTSPNEASMSPQSTSSNNSASPKACQFLYNQFPGSSQVVVKDE 214 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 23.8 bits (49), Expect = 7.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 751 TPEKEEIRREYENRLKRTKAKQVKKRLDG 779 TPE EE++R+ L+ AK +K +G Sbjct: 54 TPEGEELKRDIPEALQNECAKCNEKHKEG 82 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 286,394 Number of Sequences: 317 Number of extensions: 12440 Number of successful extensions: 37 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29 Number of HSP's gapped (non-prelim): 8 length of query: 1260 length of database: 114,650 effective HSP length: 65 effective length of query: 1195 effective length of database: 94,045 effective search space: 112383775 effective search space used: 112383775 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -