BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000981-TA|BGIBMGA000981-PA|IPR003599|Immunoglobulin subtype, IPR002345|Lipocalin, IPR009057|Homeodomain-like, IPR004875|CENP-B protein (1260 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 26 5.4 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 25 9.5 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 26.2 bits (55), Expect = 5.4 Identities = 7/22 (31%), Positives = 16/22 (72%) Query: 521 RSVFGPLKKAVNSTCDGWMRSH 542 ++ GP+++ +S CD W++S+ Sbjct: 302 KAQIGPVERVYSSICDSWLQSN 323 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 25.4 bits (53), Expect = 9.5 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 1215 YWKKTDSSSRTDNVSLQTFSAAS---WRKDSDSSGSANGSQKAGSRDI 1259 Y + D + +D V + T + S + KD+ SGS GS + G +DI Sbjct: 527 YDPEADRAMASDLVKILTQAGQSVPDFLKDAGGSGSYMGSSQFGGKDI 574 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,285,149 Number of Sequences: 2123 Number of extensions: 53506 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 115 Number of HSP's gapped (non-prelim): 2 length of query: 1260 length of database: 516,269 effective HSP length: 72 effective length of query: 1188 effective length of database: 363,413 effective search space: 431734644 effective search space used: 431734644 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -