BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000980-TA|BGIBMGA000980-PA|IPR007303|TIP41-like protein (131 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 prote... 25 1.1 AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 prote... 25 1.1 L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 22 7.8 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 22 7.8 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 22 7.8 >AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/40 (35%), Positives = 17/40 (42%) Query: 24 DALKRVASTVEPVEVSCSEVWMQARPYAEKLKKSFDWTFC 63 DA K+V TVE V+ Q +KL K D C Sbjct: 125 DAFKKVFDTVELVKAKKLPALSQYSSVVDKLMKKIDDKIC 164 >AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/40 (35%), Positives = 17/40 (42%) Query: 24 DALKRVASTVEPVEVSCSEVWMQARPYAEKLKKSFDWTFC 63 DA K+V TVE V+ Q +KL K D C Sbjct: 125 DAFKKVFDTVELVKAKKLPALSQYSSVVDKLMKKIDDKIC 164 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 21.8 bits (44), Expect = 7.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 69 SISDNITVWETEESIDFELLKQKNQIL 95 SI D + EES E+LK+ N+I+ Sbjct: 77 SIRDLFSTEHIEESRTLEILKRLNRIV 103 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 21.8 bits (44), Expect = 7.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 69 SISDNITVWETEESIDFELLKQKNQIL 95 SI D + EES E+LK+ N+I+ Sbjct: 77 SIRDLFSTEHIEESRTLEILKRLNRIV 103 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 21.8 bits (44), Expect = 7.8 Identities = 11/43 (25%), Positives = 22/43 (51%) Query: 11 AHKSGASINFNPLDALKRVASTVEPVEVSCSEVWMQARPYAEK 53 A+KS + + ++ L++ S++ SC+EV+ P K Sbjct: 99 AYKSFTEVESSKVNELQQALSSLNAGSGSCAEVFNAYLPVHNK 141 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.133 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,381 Number of Sequences: 2123 Number of extensions: 4825 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 131 length of database: 516,269 effective HSP length: 58 effective length of query: 73 effective length of database: 393,135 effective search space: 28698855 effective search space used: 28698855 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -