GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000979-TA|BGIBMGA000979-PA|IPR007259|Spc97/Spc98
         (694 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    24   4.0  

>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 23.8 bits (49), Expect = 4.0
 Identities = 10/38 (26%), Positives = 16/38 (42%)

Query: 427 RTGKYLNVISQCGKSISKTNTDEIKYSLREQNYGAIIQ 464
           R G +    + C  S  + N DE     R +N   +I+
Sbjct: 378 RNGTFSTTANSCRSSTFRNNRDEYNVCFRPRNNSILIK 415


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.137    0.412 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,490
Number of Sequences: 317
Number of extensions: 6230
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 694
length of database: 114,650
effective HSP length: 61
effective length of query: 633
effective length of database: 95,313
effective search space: 60333129
effective search space used: 60333129
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 46 (22.6 bits)