GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000978-TA|BGIBMGA000978-PA|undefined
         (158 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81554-6|CAB04510.2|  401|Caenorhabditis elegans Hypothetical pr...    29   1.5  

>Z81554-6|CAB04510.2|  401|Caenorhabditis elegans Hypothetical
           protein F57G4.8 protein.
          Length = 401

 Score = 29.1 bits (62), Expect = 1.5
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 74  LWNEKARLGASWNCHPRTR--LRLAPGLMGEITVQIKPRE 111
           L  E A LG+ W  +P+ R  L L   ++ EI   +KP E
Sbjct: 62  LGQENAELGSEWRFNPKCRQFLELPDDMLNEIFDHVKPIE 101


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.320    0.133    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,720,493
Number of Sequences: 27539
Number of extensions: 137004
Number of successful extensions: 263
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 263
Number of HSP's gapped (non-prelim): 1
length of query: 158
length of database: 12,573,161
effective HSP length: 76
effective length of query: 82
effective length of database: 10,480,197
effective search space: 859376154
effective search space used: 859376154
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 56 (26.6 bits)