BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000976-TA|BGIBMGA000976-PA|undefined (1465 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 2.6 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 24 7.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.8 bits (54), Expect = 2.6 Identities = 11/51 (21%), Positives = 19/51 (37%) Query: 221 NSQISSTGKQANRSGSPATATKXXXXXXXXXXXXXXXXXXGNQTDNSYSTS 271 ++ +SST + G+PAT N T N+ +T+ Sbjct: 638 DASLSSTHSHPHEPGAPATTITTITTTTTTTTTTTTTTTTPNTTQNASATT 688 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 24.2 bits (50), Expect = 7.9 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 7/66 (10%) Query: 1388 VQLYSRISHQKYLMYVECSKRVAEKRMQNPSKDTTVILNELLADEAWLSQLFRDVRHSWA 1447 + + S I + L+ + C KRV++ R+ ++L L + ++ L + WA Sbjct: 47 LMIISAIGNTTVLILITCRKRVSKSRIH-------IMLMHLAIADLLVTFLMMPLEIGWA 99 Query: 1448 EAESWE 1453 SW+ Sbjct: 100 ITVSWK 105 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.127 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 338,972 Number of Sequences: 429 Number of extensions: 12713 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 37 Number of HSP's gapped (non-prelim): 4 length of query: 1465 length of database: 140,377 effective HSP length: 67 effective length of query: 1398 effective length of database: 111,634 effective search space: 156064332 effective search space used: 156064332 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -