BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000973-TA|BGIBMGA000973-PA|IPR000719|Protein kinase, IPR000980|SH2 motif, IPR001245|Tyrosine protein kinase (159 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||M... 28 0.57 SPCC1020.08 |||wybutosine biosynthesis protein Tyw1|Schizosaccha... 27 1.7 SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosacc... 25 5.3 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 24 9.3 SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizos... 24 9.3 SPBC14C8.03 |fma2||methionine aminopeptidase Fma2 |Schizosacchar... 24 9.3 >SPBC27.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 1052 Score = 28.3 bits (60), Expect = 0.57 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 5/86 (5%) Query: 3 RQRAESLL--KREDKEGNHQQTKHYHIKQNSRGEFYLSDKHCC--ASIPEL-INYHKHNS 57 R+ A++L+ + ++K+G H+Q+ H +Q SR LS K + E ++ KH Sbjct: 116 REAAKNLMVAQAKEKKGKHKQSTIEHYEQCSRRVRELSSKIWLIERKLAEFYMHLLKHMV 175 Query: 58 GGLCSRLKATPCDRPAPPTAGLSHDK 83 + LK C + + P + ++ D+ Sbjct: 176 AVCIAELKPGSCSKVSSPVSAITADE 201 >SPCC1020.08 |||wybutosine biosynthesis protein Tyw1|Schizosaccharomyces pombe|chr 3|||Manual Length = 688 Score = 26.6 bits (56), Expect = 1.7 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 65 KATPCDRPAPPTAGLSHDKWEIDPSELVLMEVLGA 99 K T C R G S +W++DP E++L +L A Sbjct: 360 KCTFCWRHGTNPVGTSW-RWKVDPPEMILQGILKA 393 >SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 677 Score = 25.0 bits (52), Expect = 5.3 Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 3 RQRAESLLKREDKEGNHQQTKHYHIKQNSR 32 R R + + +E NH++ H+H K +R Sbjct: 599 RTRDSNPSNTDSRESNHKKYNHFHQKSQTR 628 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 24.2 bits (50), Expect = 9.3 Identities = 9/29 (31%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Query: 47 PELI-NYHKHNSGGLCSRLKATPCDRPAP 74 PE + N H+ G C + + C+ P P Sbjct: 267 PEFVKNLVPHSCGDPCGKTRGQDCEHPCP 295 >SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 855 Score = 24.2 bits (50), Expect = 9.3 Identities = 18/82 (21%), Positives = 31/82 (37%), Gaps = 1/82 (1%) Query: 8 SLLKREDKEGNHQQTKHYHIKQNSRGEFYLSDKHCCASIPELINYHKHNSGGLCSRLKAT 67 + +KR+ N + + +F+ H + P I + +NS R+KA+ Sbjct: 197 NFVKRDIDSSNFSNLDASALPISPPSDFFSVHSHNLPNAPPSIPANSNNSASPNQRIKAS 256 Query: 68 PCDRPAPPTAGLSHDKWEIDPS 89 P GL D +PS Sbjct: 257 P-KHADTDVLGLDFDMTPSEPS 277 >SPBC14C8.03 |fma2||methionine aminopeptidase Fma2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 24.2 bits (50), Expect = 9.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 62 SRLKATPCDRPAPPTAGLS 80 S+ K TP ++ PPT GLS Sbjct: 56 SKKKKTPQEQTNPPTVGLS 74 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.317 0.133 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 689,407 Number of Sequences: 5004 Number of extensions: 25268 Number of successful extensions: 56 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 53 Number of HSP's gapped (non-prelim): 6 length of query: 159 length of database: 2,362,478 effective HSP length: 68 effective length of query: 91 effective length of database: 2,022,206 effective search space: 184020746 effective search space used: 184020746 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -