BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000970-TA|BGIBMGA000970-PA|IPR009244|MED7 (219 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1467 - 33808507-33808588,33808869-33808942,33809028-338091... 77 1e-14 05_04_0209 - 19073147-19074041,19074117-19074163,19074258-190744... 31 0.73 03_05_1042 - 29893649-29893721,29893960-29894033,29894111-298941... 30 1.7 01_06_0124 - 26692731-26697046,26698749-26698827,26698899-266989... 30 1.7 08_02_0923 - 22649420-22649605,22649694-22649774,22649867-226501... 29 3.0 06_03_0092 + 16546204-16546693,16546958-16547028,16547145-165472... 29 3.9 02_05_0515 + 29689259-29689535,29689867-29690209,29690475-296907... 28 6.8 11_06_0286 + 21945699-21946213,21946255-21947542 27 9.0 04_04_0238 + 23839763-23840251,23841389-23841555,23841632-23842280 27 9.0 03_02_0424 + 8338117-8339649,8341274-8341378,8341404-8341574 27 9.0 >04_04_1467 - 33808507-33808588,33808869-33808942,33809028-33809194, 33809392-33809461,33809544-33809681 Length = 176 Score = 77.0 bits (181), Expect = 1e-14 Identities = 53/171 (30%), Positives = 77/171 (45%), Gaps = 6/171 (3%) Query: 8 SSLPLPPMQYINFYTDENVRRNRAPLPPRPIHDSYSMFGNSFNADDAIIRSLESQGFRRL 67 SS PP Y Y D + AP PP P+ Y +FG ++ D ++ SLE QG R+L Sbjct: 4 SSAYPPPPPYYRLYKDYEKDPSSAPEPPPPVDGPYQLFGATYTTD-VVLPSLEDQGVRQL 62 Query: 68 YPMH--FERRRELKKXXXXXXXXXXXXXXXXVHCPDSPKRAEKVEDXXXXXXXXXXXXNE 125 YP + ++EL+ V P + A +VED N Sbjct: 63 YPKSPDIDFKKELRTLNRELQLHILELADILVERPS--QYARRVEDISLIFKNLHHLLNS 120 Query: 126 FRPHQARETLRVMMELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQNE 176 RPHQAR TL M+E Q ++R + K+ ++ Q +L +L L D N+ Sbjct: 121 LRPHQARATLIHMLENQIQRRKQAIEDIKQRREEAQKLLGESLLIL-DGNQ 170 >05_04_0209 - 19073147-19074041,19074117-19074163,19074258-19074437, 19074839-19074955,19075105-19075227,19075391-19075776, 19076177-19076303,19077140-19077202,19078035-19078086, 19078189-19080023 Length = 1274 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 135 LRVMMELQKRQRVETAARFKKHLDKVQD-ILQNALQSLPDQNELESN 180 L V +L VE +K +D D I+ N L S+PD N+ +N Sbjct: 645 LEVFPQLNFLTLVEVCMEYKNDIDGAADYIIHNVLPSIPDNNDAHAN 691 >03_05_1042 - 29893649-29893721,29893960-29894033,29894111-29894179, 29894333-29894438,29894548-29894664,29895412-29895527, 29895612-29895698,29897281-29897309,29897914-29898169 Length = 308 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 11 PLPPMQYINFYTDENV--RRNRAPLPPRPIHDSYSMFGNSFNADDAII 56 P+PP + F+T + R R LP RP S +FG N A++ Sbjct: 53 PVPPQKVAPFFTPSKIFFHRVRLVLPFRPFGSSVPIFGEFENRVQAVL 100 >01_06_0124 - 26692731-26697046,26698749-26698827,26698899-26698955, 26699321-26699416 Length = 1515 Score = 29.9 bits (64), Expect = 1.7 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Query: 130 QARETLRVMMELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQNELESNFKVPNELLD 189 QA E LR + +RQ E ++ + + K+Q + AL +L N F+ EL Sbjct: 866 QANEELREKISSLERQLEEARSKLQDEIIKLQGEKERALDNLQQSNTSIKTFE--EELEK 923 Query: 190 QMENNT 195 Q E+N+ Sbjct: 924 QREHNS 929 >08_02_0923 - 22649420-22649605,22649694-22649774,22649867-22650146, 22650412-22650716,22650809-22650961,22651425-22652261 Length = 613 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 4/69 (5%) Query: 154 KKHLDKVQDILQNALQSLPDQNELESNFKVP--NELLDQMENNTCNIQKAD-PCFELDRI 210 KK+ K Q+ ++ +QSL Q++L S F++P E ++ ++ + D P D + Sbjct: 510 KKNAIKFQNYFESTIQSLSKQHDL-SQFRLPPLPEFPSELSSHPVTTRPGDTPVDPADNV 568 Query: 211 MCNVVDNMR 219 NV ++ R Sbjct: 569 AANVPEDSR 577 >06_03_0092 + 16546204-16546693,16546958-16547028,16547145-16547221, 16547322-16547469,16550080-16550148,16550348-16550509, 16550625-16550785,16551240-16551324,16552068-16552144, 16552234-16552441,16555844-16555921,16556463-16556591, 16556665-16556808,16556893-16557038,16557137-16557293, 16557391-16557449,16557582-16557741,16557849-16557998, 16558093-16558229,16558325-16558471,16558556-16558657, 16558742-16558799,16558895-16558996,16559729-16559766, 16559868-16559994,16560075-16560245,16560334-16560465, 16560577-16560686,16560866-16560926,16561031-16561208, 16561293-16561498,16561590-16561709,16561903-16562001, 16562152-16562370,16562701-16562840,16563175-16563286, 16563375-16563425,16563509-16563589,16563683-16563853, 16563934-16564089,16564174-16564380,16565145-16565215, 16565315-16565414,16565783-16565839,16566156-16566212, 16566308-16566388,16566467-16566606,16566641-16566764 Length = 2041 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/37 (35%), Positives = 24/37 (64%) Query: 139 MELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQN 175 +++QK QR+ A R KHL+ ++Q AL+++ +N Sbjct: 1329 IKVQKNQRMHQARRSYKHLNASVLVVQTALRAMAARN 1365 >02_05_0515 + 29689259-29689535,29689867-29690209,29690475-29690746, 29691282-29691478,29691874-29692237,29692831-29692898 Length = 506 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 34 PPRPIHDSYSMFGNSFNADDAI 55 PP +H YS FG SF DA+ Sbjct: 65 PPSRVHPHYSGFGFSFTVTDAV 86 >11_06_0286 + 21945699-21946213,21946255-21947542 Length = 600 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 171 LPDQNELE-SNFKVPNELLDQMENNTCNIQKAD 202 LP ELE +N VPNEL + +ENN I K + Sbjct: 566 LPKFKELELNNSHVPNELKEAVENNKRIILKCN 598 >04_04_0238 + 23839763-23840251,23841389-23841555,23841632-23842280 Length = 434 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query: 156 HLDKVQDILQNALQSLPDQNELESNFKVPNELLDQMENNTCNIQKADPCFELD 208 HL++++ + NAL SLPD L N ++ N +++ + +I K ELD Sbjct: 174 HLEELR-LASNALISLPDSIGLLLNLRILNVGSNRLRSLPDSISKCRSLIELD 225 >03_02_0424 + 8338117-8339649,8341274-8341378,8341404-8341574 Length = 602 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 8 SSLPLPPMQYINFYTDENVRRNRAPLPPRPIHDSYSMFGNSFNADDAIIR 57 S + LPP + Y A LPP I+ S + GNSF+++ +++ Sbjct: 170 SYIVLPPAA-ASIYKTSTSEGGGAQLPPPSINSSSLLTGNSFHSNVTVLK 218 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,450,413 Number of Sequences: 37544 Number of extensions: 199623 Number of successful extensions: 526 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 521 Number of HSP's gapped (non-prelim): 10 length of query: 219 length of database: 14,793,348 effective HSP length: 79 effective length of query: 140 effective length of database: 11,827,372 effective search space: 1655832080 effective search space used: 1655832080 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -