BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000970-TA|BGIBMGA000970-PA|IPR009244|MED7 (219 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03500.1 68418.m00306 transcriptional co-activator-related lo... 82 2e-16 At5g03220.1 68418.m00270 transcriptional co-activator-related co... 82 3e-16 At5g42920.2 68418.m05233 expressed protein 29 1.9 At5g42920.1 68418.m05232 expressed protein 29 1.9 At3g24120.1 68416.m03028 myb family transcription factor contain... 29 3.3 At1g45233.2 68414.m05190 expressed protein Since this genomic se... 28 4.3 At5g54320.1 68418.m06765 hypothetical protein contains Pfam prof... 28 5.7 At4g13640.1 68417.m02122 myb family transcription factor contain... 28 5.7 At3g32190.1 68416.m04102 hypothetical protein 27 7.5 At1g60780.1 68414.m06842 clathrin adaptor complexes medium subun... 27 7.5 At5g42390.1 68418.m05161 metalloendopeptidase identical to chlor... 27 10.0 At5g34895.1 68418.m04113 hypothetical protein similar to At2g049... 27 10.0 At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 27 10.0 At2g43040.1 68415.m05341 calmodulin-binding protein similar to p... 27 10.0 At2g39300.1 68415.m04825 expressed protein ; expression supporte... 27 10.0 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 10.0 At1g10730.1 68414.m01223 clathrin adaptor complexes medium subun... 27 10.0 >At5g03500.1 68418.m00306 transcriptional co-activator-related low similarity to transcriptional co-activator CRSP33 [Homo sapiens] GI:4220890 Length = 443 Score = 82.2 bits (194), Expect = 2e-16 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 5/163 (3%) Query: 13 PPMQYINFYTDENVRRNRAPLPPRPIHDSYSMFGNSFNADDAIIRSLESQGFRRLYPM-- 70 PP Y Y D + + AP PP PI +Y FG ++ +D ++ SLE QG +LYP Sbjct: 8 PPPPYYRLYKDFSENTDSAPEPPPPIEGTYVCFGGNYTTED-VLPSLEEQGVPQLYPKDS 66 Query: 71 HFERRRELKKXXXXXXXXXXXXXXXXVHCPDSPKRAEKVEDXXXXXXXXXXXXNEFRPHQ 130 + + ++EL+ V P + A+++ + N RPHQ Sbjct: 67 NLDYKKELRSLNRELQLHILELADVLVDRPS--QYAKRIGEISSIFKNLHHLLNSLRPHQ 124 Query: 131 ARETLRVMMELQKRQRVETAARFKKHLDKVQDILQNALQSLPD 173 AR TL +MELQ +QR + K+ ++ Q +L++A +L D Sbjct: 125 ARATLIHIMELQIQQRKQAVEDIKRRREEAQGLLKDAFVTLDD 167 >At5g03220.1 68418.m00270 transcriptional co-activator-related contains weak similarity to Cofactor required for Sp1 transcriptional activation subunit 9 (Transcriptional co-activator CRSP33) (RNA polymerase transcriptional regulation mediator subunit 7 homolog) (hMED7) (Activator-recruited cofactor 34 kDa component) (ARC34) (Swiss-Prot:O43513) [Homo sapiens] Length = 168 Score = 81.8 bits (193), Expect = 3e-16 Identities = 50/164 (30%), Positives = 77/164 (46%), Gaps = 5/164 (3%) Query: 13 PPMQYINFYTDENVRRNRAPLPPRPIHDSYSMFGNSFNADDAIIRSLESQGFRRLYPM-- 70 PP Y Y D + N AP PP PI +Y FG ++ +D ++ SLE QG +LYP Sbjct: 8 PPPPYYRLYKDYSENPNSAPEPPPPIEGTYVCFGGNYTTED-VLPSLEEQGVPQLYPKDS 66 Query: 71 HFERRRELKKXXXXXXXXXXXXXXXXVHCPDSPKRAEKVEDXXXXXXXXXXXXNEFRPHQ 130 + + + EL+ V P + A+++ + N RPHQ Sbjct: 67 NLDYKNELRSLNRELQLHILELADVLVDRPS--QYAKRIGEISSIFKNLHHLLNSLRPHQ 124 Query: 131 ARETLRVMMELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQ 174 AR TL +MELQ +QR + K+ ++ Q +L++A +L Q Sbjct: 125 ARATLIHIMELQIQQRKQAVEDIKRRREEAQRLLKDAYLTLDGQ 168 >At5g42920.2 68418.m05233 expressed protein Length = 819 Score = 29.5 bits (63), Expect = 1.9 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 126 FRPHQARETL--RVMMELQKRQRVETAARFKKHLDKVQDILQNALQ-SLPDQNEL 177 F HQ +E R +E QK+ +ET A KK L + L++ + SLP QN L Sbjct: 177 FELHQRKELCKHRARLEQQKKSLLETIAERKKFLSSLPLHLKSLKKASLPVQNHL 231 >At5g42920.1 68418.m05232 expressed protein Length = 702 Score = 29.5 bits (63), Expect = 1.9 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 126 FRPHQARETL--RVMMELQKRQRVETAARFKKHLDKVQDILQNALQ-SLPDQNEL 177 F HQ +E R +E QK+ +ET A KK L + L++ + SLP QN L Sbjct: 60 FELHQRKELCKHRARLEQQKKSLLETIAERKKFLSSLPLHLKSLKKASLPVQNHL 114 >At3g24120.1 68416.m03028 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 295 Score = 28.7 bits (61), Expect = 3.3 Identities = 21/91 (23%), Positives = 42/91 (46%), Gaps = 8/91 (8%) Query: 129 HQARETLRVMMELQKR--QRVETAARFKKHLDK----VQDILQNALQSLPDQNELESNFK 182 +Q E LR ME+Q+R ++E R + ++ +Q IL+ A ++ +Q + + Sbjct: 138 YQVTEALRAQMEVQRRLHDQLEVQRRLQLRIEAQGKYLQSILEKACKAFDEQAATFAGLE 197 Query: 183 VPNELLDQMENNTCNIQKAD--PCFELDRIM 211 E L ++ N + P F+ ++M Sbjct: 198 AAREELSELAIKVSNSSQGTSVPYFDATKMM 228 >At1g45233.2 68414.m05190 expressed protein Since this genomic sequence region is unfinished, the annotated gene may be missing a stop codon or start codon Length = 448 Score = 28.3 bits (60), Expect = 4.3 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Query: 126 FRPHQARET--LRVMMELQKRQRVETAARFKKHLDKVQDILQNALQ-SLPDQNEL 177 F HQ +E LRV +E QK+ +E+ A K L + L++ + SLP Q++L Sbjct: 153 FELHQRKELCKLRVRLEQQKKSLLESNAERNKFLSSLPVHLKSLKKASLPVQSQL 207 >At5g54320.1 68418.m06765 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 369 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 190 QMENNTCNIQKADPCFELDRIMCNVVDNM 218 Q + NI+ +PCF L R+M + DNM Sbjct: 173 QSNSEWINIRIENPCFYLSRVMYSKKDNM 201 >At4g13640.1 68417.m02122 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 292 Score = 27.9 bits (59), Expect = 5.7 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 6/69 (8%) Query: 129 HQARETLRVMMELQKR--QRVETAARFKKHLDK----VQDILQNALQSLPDQNELESNFK 182 +Q E LR ME+Q+R +++E R + ++ +Q IL+ A +++ +Q + + Sbjct: 134 YQVTEALRAQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKAIEEQAVAFAGLE 193 Query: 183 VPNELLDQM 191 E L ++ Sbjct: 194 AAREELSEL 202 >At3g32190.1 68416.m04102 hypothetical protein Length = 358 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/46 (28%), Positives = 29/46 (63%) Query: 157 LDKVQDILQNALQSLPDQNELESNFKVPNELLDQMENNTCNIQKAD 202 LD+ QD++ +S +++L S+ +V +L DQ+EN + + +++ Sbjct: 67 LDREQDVMAWKDKSSSLESDLRSSTEVKQKLEDQLENLSSKLMQSN 112 >At1g60780.1 68414.m06842 clathrin adaptor complexes medium subunit family protein contains Pfam profile: PF00928 adaptor complexes medium subunit family Length = 428 Score = 27.5 bits (58), Expect = 7.5 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Query: 137 VMMELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQNELESNFKVPNELLDQM 191 V + + RQ AA L +V D+ ++ + L +++ L NF V ELLD+M Sbjct: 68 VYLMIASRQNCN-AASLLFFLHRVVDVFKHYFEELEEES-LRDNFVVVYELLDEM 120 >At5g42390.1 68418.m05161 metalloendopeptidase identical to chloroplast processing enzyme metalloendopeptidase [Arabidopsis thaliana] gi|2827039|gb|AAC39482 Length = 1265 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 162 DILQNALQSLPDQNELESNFKVPNELLDQMENNTCNIQKADPCF 205 +I+++ L E E +VP EL+ Q + +Q+ +PCF Sbjct: 702 EIIESVKSGLLAPIEAEPELEVPKELISQSQLKELTLQR-NPCF 744 >At5g34895.1 68418.m04113 hypothetical protein similar to At2g04970, At2g15200, At1g32830, At2g14140, At3g30450, At4g03990, At3g47270, At2g02200 Length = 490 Score = 27.1 bits (57), Expect = 10.0 Identities = 9/47 (19%), Positives = 26/47 (55%) Query: 156 HLDKVQDILQNALQSLPDQNELESNFKVPNELLDQMENNTCNIQKAD 202 H ++ +L+ A++++ Q+ + ++ EN+TCN+++ + Sbjct: 189 HQGRIDHVLKPAIETVVHQSRKRKSMSFGEKVKLVYENSTCNVEETE 235 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Query: 143 KRQRVETAARFKKHLD--KVQDILQNALQSLPDQNE 176 K+ +ETA KH K+QD+L+NA +L D + Sbjct: 377 KKSEMETAFFELKHCPPLKIQDVLKNAYSALSDNEK 412 >At2g43040.1 68415.m05341 calmodulin-binding protein similar to pollen-specific calmodulin-binding protein MPCBP GI:10086260 from [Zea mays]; contains Pfam profile PF00515: TPR Domain Length = 704 Score = 27.1 bits (57), Expect = 10.0 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 141 LQKRQRV-ETAARFKKHLDKVQDILQNALQSLPDQNELESNFKVPNELLDQMENNTCNIQ 199 LQK R+ E A K LD V+ I Q + N+L+ ELL + + + Q Sbjct: 135 LQKLGRITEAAHECKSVLDSVEKIFQQGIPDAQVDNKLQETVSHAVELLPALWKESGDYQ 194 Query: 200 KA 201 +A Sbjct: 195 EA 196 >At2g39300.1 68415.m04825 expressed protein ; expression supported by MPSS Length = 768 Score = 27.1 bits (57), Expect = 10.0 Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 5/68 (7%) Query: 133 ETLRVM-MELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQNELESNFKVPNELLDQM 191 E LR++ +EL R+ VE+ + L + + L N ++ ++ ++ + FK+ NE M Sbjct: 512 EQLRLVGVELSLRKEVESMKLEAESLRRENNCLLNRVKGNGEEADIMTTFKLDNE----M 567 Query: 192 ENNTCNIQ 199 + C++Q Sbjct: 568 KMRVCHLQ 575 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.1 bits (57), Expect = 10.0 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 6/87 (6%) Query: 132 RETLRVMMELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQ--NELESNFKVPNELLD 189 + ++ V+M+L K V + HL + + +L SL DQ N +E + + Sbjct: 1288 KASIGVVMKLAKGAGVA----LRPHLSDLVCCMLESLSSLEDQGLNYVELHAANIGIETE 1343 Query: 190 QMENNTCNIQKADPCFELDRIMCNVVD 216 ++EN +I K P +E + N+VD Sbjct: 1344 KLENLRISISKGSPMWETLDLCINIVD 1370 >At1g10730.1 68414.m01223 clathrin adaptor complexes medium subunit family protein contains Pfam profile: PF00928 adaptor complexes medium subunit family Length = 428 Score = 27.1 bits (57), Expect = 10.0 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Query: 137 VMMELQKRQRVETAARFKKHLDKVQDILQNALQSLPDQNELESNFKVPNELLDQM 191 + + + RQ AA L +V D+ ++ + L +++ L NF V ELLD+M Sbjct: 68 IYLMIASRQNCN-AASLLFFLHRVVDVFKHYFEELEEES-LRDNFVVVYELLDEM 120 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,493,367 Number of Sequences: 28952 Number of extensions: 166865 Number of successful extensions: 512 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 503 Number of HSP's gapped (non-prelim): 17 length of query: 219 length of database: 12,070,560 effective HSP length: 78 effective length of query: 141 effective length of database: 9,812,304 effective search space: 1383534864 effective search space used: 1383534864 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -