BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000969-TA|BGIBMGA000969-PA|undefined (69 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC107762-1|AAI07763.1| 172|Homo sapiens DISP1 protein protein. 27 9.4 >BC107762-1|AAI07763.1| 172|Homo sapiens DISP1 protein protein. Length = 172 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/60 (25%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Query: 5 HVVTSGPKHMRGSHGAGDLYPTERLACRDVXXXXXXXXXLSYNGKKAKEKTCCICPPPNY 64 H +TS H AG P+ +C + L N + TCC+ P P++ Sbjct: 89 HPLTSHSSHQECHPNAGPAAPSALASCC-MQPHSEYSASLCPNHSPVYQTTCCLQPSPSF 147 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.318 0.136 0.447 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,510,070 Number of Sequences: 224733 Number of extensions: 308830 Number of successful extensions: 430 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 430 Number of HSP's gapped (non-prelim): 1 length of query: 69 length of database: 73,234,838 effective HSP length: 48 effective length of query: 21 effective length of database: 62,447,654 effective search space: 1311400734 effective search space used: 1311400734 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -