GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000969-TA|BGIBMGA000969-PA|undefined
         (69 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC107762-1|AAI07763.1|  172|Homo sapiens DISP1 protein protein.        27   9.4  

>BC107762-1|AAI07763.1|  172|Homo sapiens DISP1 protein protein.
          Length = 172

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 15/60 (25%), Positives = 23/60 (38%), Gaps = 1/60 (1%)

Query: 5   HVVTSGPKHMRGSHGAGDLYPTERLACRDVXXXXXXXXXLSYNGKKAKEKTCCICPPPNY 64
           H +TS   H      AG   P+   +C  +         L  N     + TCC+ P P++
Sbjct: 89  HPLTSHSSHQECHPNAGPAAPSALASCC-MQPHSEYSASLCPNHSPVYQTTCCLQPSPSF 147


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.318    0.136    0.447 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,510,070
Number of Sequences: 224733
Number of extensions: 308830
Number of successful extensions: 430
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 430
Number of HSP's gapped (non-prelim): 1
length of query: 69
length of database: 73,234,838
effective HSP length: 48
effective length of query: 21
effective length of database: 62,447,654
effective search space: 1311400734
effective search space used: 1311400734
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 57 (27.1 bits)