GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000968-TA|BGIBMGA000968-PA|undefined
         (55 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7PX10 Cluster: ENSANGP00000004133; n=3; Coelomata|Rep:...    31   4.6  

>UniRef50_Q7PX10 Cluster: ENSANGP00000004133; n=3; Coelomata|Rep:
            ENSANGP00000004133 - Anopheles gambiae str. PEST
          Length = 5321

 Score = 31.1 bits (67), Expect = 4.6
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 10   PHCIIPRRVFIWHQRKTSTTTVDQLPKPATGPSD 43
            P+C++    F+ H +  S +++D+L  PA G S+
Sbjct: 3188 PYCLMIMESFLPHWKNASASSIDELASPAIGASN 3221


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.327    0.137    0.450 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,801,678
Number of Sequences: 1657284
Number of extensions: 1794998
Number of successful extensions: 5202
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5201
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 575,637,011
effective HSP length: 35
effective length of query: 20
effective length of database: 517,632,071
effective search space: 10352641420
effective search space used: 10352641420
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 65 (30.3 bits)