BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000968-TA|BGIBMGA000968-PA|undefined
(55 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q7PX10 Cluster: ENSANGP00000004133; n=3; Coelomata|Rep:... 31 4.6
>UniRef50_Q7PX10 Cluster: ENSANGP00000004133; n=3; Coelomata|Rep:
ENSANGP00000004133 - Anopheles gambiae str. PEST
Length = 5321
Score = 31.1 bits (67), Expect = 4.6
Identities = 11/34 (32%), Positives = 21/34 (61%)
Query: 10 PHCIIPRRVFIWHQRKTSTTTVDQLPKPATGPSD 43
P+C++ F+ H + S +++D+L PA G S+
Sbjct: 3188 PYCLMIMESFLPHWKNASASSIDELASPAIGASN 3221
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.327 0.137 0.450
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,801,678
Number of Sequences: 1657284
Number of extensions: 1794998
Number of successful extensions: 5202
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5201
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 575,637,011
effective HSP length: 35
effective length of query: 20
effective length of database: 517,632,071
effective search space: 10352641420
effective search space used: 10352641420
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 65 (30.3 bits)
- SilkBase 1999-2023 -