BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000968-TA|BGIBMGA000968-PA|undefined (55 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7PX10 Cluster: ENSANGP00000004133; n=3; Coelomata|Rep:... 31 4.6 >UniRef50_Q7PX10 Cluster: ENSANGP00000004133; n=3; Coelomata|Rep: ENSANGP00000004133 - Anopheles gambiae str. PEST Length = 5321 Score = 31.1 bits (67), Expect = 4.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Query: 10 PHCIIPRRVFIWHQRKTSTTTVDQLPKPATGPSD 43 P+C++ F+ H + S +++D+L PA G S+ Sbjct: 3188 PYCLMIMESFLPHWKNASASSIDELASPAIGASN 3221 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.327 0.137 0.450 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,801,678 Number of Sequences: 1657284 Number of extensions: 1794998 Number of successful extensions: 5202 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5201 Number of HSP's gapped (non-prelim): 1 length of query: 55 length of database: 575,637,011 effective HSP length: 35 effective length of query: 20 effective length of database: 517,632,071 effective search space: 10352641420 effective search space used: 10352641420 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -