BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000967-TA|BGIBMGA000967-PA|undefined (84 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 21 4.5 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 21 7.8 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 21.4 bits (43), Expect = 4.5 Identities = 13/48 (27%), Positives = 20/48 (41%) Query: 21 KSVACSASGAAPIDAYLKVVNAALCEIMQSKIKSVACSASGAAPMDAY 68 KSVA A+ + PI L+ + I ++C A P + Y Sbjct: 74 KSVAVVATSSYPIQRVLRSAVPGIVAAQIGGIVFISCYARPRRPEEDY 121 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/34 (26%), Positives = 16/34 (47%) Query: 13 CEIIQSKIKSVACSASGAAPIDAYLKVVNAALCE 46 C +I A S A P++A +++ A C+ Sbjct: 3 CAVITRDFAMAAICFSCAEPLEATGCIISCAYCD 36 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.128 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,022 Number of Sequences: 2123 Number of extensions: 1842 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 84 length of database: 516,269 effective HSP length: 53 effective length of query: 31 effective length of database: 403,750 effective search space: 12516250 effective search space used: 12516250 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -