BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000967-TA|BGIBMGA000967-PA|undefined (84 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 20 4.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 19 6.4 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 19.8 bits (39), Expect = 4.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 15 IIQSKIKSVACSASGAAPID 34 + ++ I +VAC A+PID Sbjct: 1 MFRATIVTVACLLLAASPID 20 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 19.4 bits (38), Expect = 6.4 Identities = 22/82 (26%), Positives = 34/82 (41%), Gaps = 6/82 (7%) Query: 6 KMVDAALCEIIQSKIKSVACSASGAAPIDAYLKVVNAAL-CEIMQSK-IKSVACSASGAA 63 KMV+ E+IQSK + K +A L C +K + S SG A Sbjct: 257 KMVNQKFSELIQSKPQHARRKVLAGI---VQTKGSDAELICVTTGTKCVSGEHLSVSGGA 313 Query: 64 PMDAYLKIV-DAALCEIIQSKI 84 D + ++V LCE + ++ Sbjct: 314 LNDCHAEVVARRCLCEYLYKQL 335 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.128 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,788 Number of Sequences: 429 Number of extensions: 427 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 84 length of database: 140,377 effective HSP length: 47 effective length of query: 37 effective length of database: 120,214 effective search space: 4447918 effective search space used: 4447918 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (20.1 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -