BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000964-TA|BGIBMGA000964-PA|IPR011041|Soluble quinoprotein glucose dehydrogenase, IPR006530|YD repeat, IPR001258|NHL repeat (1954 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 25 3.9 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 24 8.9 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 24 8.9 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 24 8.9 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 24 8.9 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 25.4 bits (53), Expect = 3.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 1639 SLAPQLYPDELPGGSVLPSIP 1659 S+ +LYP +PG S P++P Sbjct: 317 SVMTELYPSPVPGHSTSPNLP 337 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 24.2 bits (50), Expect = 8.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 1781 VHGDQQDVFYFVKEETWRAADDKQQL 1806 V DQQ V Y K++ W DD++ + Sbjct: 309 VFDDQQKVPYKYKDDQWIGYDDEESV 334 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 24.2 bits (50), Expect = 8.9 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 934 LLEAALPIEAEMLHMWSHQTTTFG-DGLTNN-MYSL 967 +LE+A+P++ +LH +TT+ D LT +YS+ Sbjct: 73 ILESAIPMKGRLLHDLKGRTTSVPYDALTGQCIYSI 108 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 24.2 bits (50), Expect = 8.9 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 934 LLEAALPIEAEMLHMWSHQTTTFG-DGLTNN-MYSL 967 +LE+A+P++ +LH +TT+ D LT +YS+ Sbjct: 73 ILESAIPMKGRLLHDLKGRTTSVPYDALTGQCIYSI 108 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 24.2 bits (50), Expect = 8.9 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 934 LLEAALPIEAEMLHMWSHQTTTFG-DGLTNN-MYSL 967 +LE+A+P++ +LH +TT+ D LT +YS+ Sbjct: 73 ILESAIPMKGRLLHDLKGRTTSVPYDALTGQCIYSI 108 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 466,528 Number of Sequences: 317 Number of extensions: 21729 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 25 Number of HSP's gapped (non-prelim): 5 length of query: 1954 length of database: 114,650 effective HSP length: 67 effective length of query: 1887 effective length of database: 93,411 effective search space: 176266557 effective search space used: 176266557 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -