Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000962-TA|BGIBMGA000962-PA|undefined
         (99 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) co...    25   6.4  

>At5g42400.1 68418.m05162 SET domain-containing protein (TXR7)
           contains Pfam profile PF00856: SET domain
          Length = 1423

 Score = 25.4 bits (53), Expect = 6.4
 Identities = 8/41 (19%), Positives = 21/41 (51%)

Query: 44  IFYFVICKDSACWISDTDCIREISVNGSDYFRGTFSSHTGR 84
           +FY  +   S+CW  +    R   ++  +Y +G+ + ++ +
Sbjct: 466 VFYDTVATHSSCWRKNKIWFRSSDISTVNYCKGSHTKYSDK 506


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.326    0.140    0.436 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,093,727
Number of Sequences: 28952
Number of extensions: 70057
Number of successful extensions: 110
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 109
Number of HSP's gapped (non-prelim): 1
length of query: 99
length of database: 12,070,560
effective HSP length: 70
effective length of query: 29
effective length of database: 10,043,920
effective search space: 291273680
effective search space used: 291273680
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 52 (25.0 bits)