SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000962-TA|BGIBMGA000962-PA|undefined
         (99 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF321227-6|AAK16426.1|  150|Tribolium castaneum Pb protein.            21   3.2  

>AF321227-6|AAK16426.1|  150|Tribolium castaneum Pb protein.
          Length = 150

 Score = 20.6 bits (41), Expect = 3.2
 Identities = 9/30 (30%), Positives = 14/30 (46%)

Query: 56  WISDTDCIREISVNGSDYFRGTFSSHTGRI 85
           W+ +    R+ S  G+  FR T  + T  I
Sbjct: 117 WMKEKKTTRKSSQQGNFEFRNTVGATTANI 146


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.326    0.140    0.436 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,117
Number of Sequences: 317
Number of extensions: 764
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 99
length of database: 114,650
effective HSP length: 48
effective length of query: 51
effective length of database: 99,434
effective search space:  5071134
effective search space used:  5071134
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (20.2 bits)
S2: 37 (19.0 bits)

- SilkBase 1999-2023 -