BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000962-TA|BGIBMGA000962-PA|undefined (99 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC354.07c |||oxysterol binding protein |Schizosaccharomyces po... 27 0.70 SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizo... 25 2.8 >SPBC354.07c |||oxysterol binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 399 Score = 26.6 bits (56), Expect = 0.70 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 57 ISDTDCIREISVNGSDYFRGTFSSHTGRI 85 +S+T+ I +I +G YFRGT +S I Sbjct: 219 VSNTNYITKIDYSGRGYFRGTKNSFKATI 247 >SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1513 Score = 24.6 bits (51), Expect = 2.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 42 PRIFYFVICKDSACWISDTDCIREISVNGSDY 73 P F+ C + +I DC++E+S+N + + Sbjct: 652 PCFLSFMQCHEPKKFICLGDCVKEVSLNATSW 683 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.326 0.140 0.436 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 410,848 Number of Sequences: 5004 Number of extensions: 13522 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 2 length of query: 99 length of database: 2,362,478 effective HSP length: 63 effective length of query: 36 effective length of database: 2,047,226 effective search space: 73700136 effective search space used: 73700136 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -