BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000961-TA|BGIBMGA000961-PA|undefined (92 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8XS39 Cluster: Probable non ribosomal peptide syntheta... 31 3.4 UniRef50_A4F6N3 Cluster: Putative uncharacterized protein; n=1; ... 31 4.5 >UniRef50_Q8XS39 Cluster: Probable non ribosomal peptide synthetase protein; n=2; Proteobacteria|Rep: Probable non ribosomal peptide synthetase protein - Ralstonia solanacearum (Pseudomonas solanacearum) Length = 5953 Score = 31.5 bits (68), Expect = 3.4 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 18 HKYSGARGSTETKMISLWLKALLAVETI 45 H Y R ET++ S+W +ALL VETI Sbjct: 5296 HSYEAPRSGIETRLASIW-QALLGVETI 5322 >UniRef50_A4F6N3 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 180 Score = 31.1 bits (67), Expect = 4.5 Identities = 14/41 (34%), Positives = 25/41 (60%) Query: 29 TKMISLWLKALLAVETIPQDHQCRVLQQDTRAPVTTGIRSL 69 T ++++WL A L T P++ + R L+++ +TTG SL Sbjct: 62 TPLLAVWLDAALHFCTGPEERKARNLERNAHCVLTTGRNSL 102 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.321 0.133 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,714,737 Number of Sequences: 1657284 Number of extensions: 2808682 Number of successful extensions: 5032 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5031 Number of HSP's gapped (non-prelim): 2 length of query: 92 length of database: 575,637,011 effective HSP length: 70 effective length of query: 22 effective length of database: 459,627,131 effective search space: 10111796882 effective search space used: 10111796882 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -