BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000961-TA|BGIBMGA000961-PA|undefined
(92 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 20 4.4
AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 19 7.6
>AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin
protein.
Length = 339
Score = 20.2 bits (40), Expect = 4.4
Identities = 7/11 (63%), Positives = 9/11 (81%)
Query: 15 RTPHKYSGARG 25
R+P +Y GARG
Sbjct: 303 RSPFRYLGARG 313
>AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein
75 protein.
Length = 900
Score = 19.4 bits (38), Expect = 7.6
Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%)
Query: 10 IAGAGRTPHKYSGARGSTETKMISLWLKALLAVETIPQDHQCRVLQQDTRAPVTTG 65
+AG G PH+ GST + L +L PQ + R L + + + +G
Sbjct: 531 LAG-GLCPHRRRANSGSTSSGDDELHRASLSKTPQPPQCPRFRKLDSPSDSGIESG 585
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.321 0.133 0.399
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,513
Number of Sequences: 429
Number of extensions: 677
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 92
length of database: 140,377
effective HSP length: 48
effective length of query: 44
effective length of database: 119,785
effective search space: 5270540
effective search space used: 5270540
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.5 bits)
S2: 38 (19.4 bits)
- SilkBase 1999-2023 -