GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000961-TA|BGIBMGA000961-PA|undefined
         (92 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB073998-1|BAC76402.1|  339|Apis mellifera preprotachykinin prot...    20   4.4  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    19   7.6  

>AB073998-1|BAC76402.1|  339|Apis mellifera preprotachykinin
           protein.
          Length = 339

 Score = 20.2 bits (40), Expect = 4.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)

Query: 15  RTPHKYSGARG 25
           R+P +Y GARG
Sbjct: 303 RSPFRYLGARG 313


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 19.4 bits (38), Expect = 7.6
 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%)

Query: 10  IAGAGRTPHKYSGARGSTETKMISLWLKALLAVETIPQDHQCRVLQQDTRAPVTTG 65
           +AG G  PH+     GST +    L   +L      PQ  + R L   + + + +G
Sbjct: 531 LAG-GLCPHRRRANSGSTSSGDDELHRASLSKTPQPPQCPRFRKLDSPSDSGIESG 585


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.133    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,513
Number of Sequences: 429
Number of extensions: 677
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 92
length of database: 140,377
effective HSP length: 48
effective length of query: 44
effective length of database: 119,785
effective search space:  5270540
effective search space used:  5270540
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.5 bits)
S2: 38 (19.4 bits)