BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000961-TA|BGIBMGA000961-PA|undefined (92 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 20 4.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 19 7.6 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 20.2 bits (40), Expect = 4.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 15 RTPHKYSGARG 25 R+P +Y GARG Sbjct: 303 RSPFRYLGARG 313 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 19.4 bits (38), Expect = 7.6 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 10 IAGAGRTPHKYSGARGSTETKMISLWLKALLAVETIPQDHQCRVLQQDTRAPVTTG 65 +AG G PH+ GST + L +L PQ + R L + + + +G Sbjct: 531 LAG-GLCPHRRRANSGSTSSGDDELHRASLSKTPQPPQCPRFRKLDSPSDSGIESG 585 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.133 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,513 Number of Sequences: 429 Number of extensions: 677 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 92 length of database: 140,377 effective HSP length: 48 effective length of query: 44 effective length of database: 119,785 effective search space: 5270540 effective search space used: 5270540 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.5 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -