SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000960-TA|BGIBMGA000960-PA|undefined
         (153 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z78540-3|CAB01735.2|  482|Caenorhabditis elegans Hypothetical pr...    27   7.8  

>Z78540-3|CAB01735.2|  482|Caenorhabditis elegans Hypothetical
           protein C33G3.5 protein.
          Length = 482

 Score = 26.6 bits (56), Expect = 7.8
 Identities = 17/59 (28%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 4   EQRRIYGSE-AGDNPPRYVSSPQRQASPFPLESTXXXXXXXXXXSKGEEIFSGDVGGGT 61
           E    Y  E AG   P+Y+    R+ S F  +ST          S   EI S ++   T
Sbjct: 355 EDESAYTRENAGPLDPQYIPPATRRTSEFSTDSTTVESTTIHVSSTATEISSTEIETST 413


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.313    0.134    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,045,226
Number of Sequences: 27539
Number of extensions: 88421
Number of successful extensions: 108
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 108
Number of HSP's gapped (non-prelim): 1
length of query: 153
length of database: 12,573,161
effective HSP length: 75
effective length of query: 78
effective length of database: 10,507,736
effective search space: 819603408
effective search space used: 819603408
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 56 (26.6 bits)

- SilkBase 1999-2023 -