BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000959-TA|BGIBMGA000959-PA|IPR000054|Ribosomal protein L31e (124 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical pr... 155 7e-39 Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical pr... 86 8e-18 AC024860-2|AAN84888.1| 173|Caenorhabditis elegans Hypothetical ... 26 6.8 >Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical protein W09C5.6a protein. Length = 122 Score = 155 bits (377), Expect = 7e-39 Identities = 69/120 (57%), Positives = 89/120 (74%) Query: 4 PKGERTGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDT 63 PK E+ +S INEVVTREYT+++H R+ G+G KKRAPRAI EI+KFA+ QM T D+RVDT Sbjct: 3 PKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDT 62 Query: 64 RLNKFLWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 123 +LNKF+WSKG++NVP+ N+DEDSA KL+TL TYVP + GL NVD+ + Sbjct: 63 KLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 122 >Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical protein W09C5.6b protein. Length = 70 Score = 85.8 bits (203), Expect = 8e-18 Identities = 37/70 (52%), Positives = 48/70 (68%) Query: 54 MGTPDIRVDTRLNKFLWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKG 113 M T D+RVDT+LNKF+WSKG++NVP+ N+DEDSA KL+TL TYVP + G Sbjct: 1 MKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHG 60 Query: 114 LQTENVDASQ 123 L NVD+ + Sbjct: 61 LTNVNVDSEE 70 >AC024860-2|AAN84888.1| 173|Caenorhabditis elegans Hypothetical protein Y71H2AR.3 protein. Length = 173 Score = 26.2 bits (55), Expect = 6.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 31 HGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 61 + V K + P+ I++IRKF + + +PD V Sbjct: 126 YNVDSKIKQPQVIEDIRKFVKIHVDSPDSEV 156 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,666,062 Number of Sequences: 27539 Number of extensions: 88032 Number of successful extensions: 152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 149 Number of HSP's gapped (non-prelim): 3 length of query: 124 length of database: 12,573,161 effective HSP length: 73 effective length of query: 51 effective length of database: 10,562,814 effective search space: 538703514 effective search space used: 538703514 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -