BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000959-TA|BGIBMGA000959-PA|IPR000054|Ribosomal protein L31e (124 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 116 1e-27 SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp... 25 4.6 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 116 bits (278), Expect = 1e-27 Identities = 57/104 (54%), Positives = 74/104 (71%), Gaps = 2/104 (1%) Query: 9 TGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 68 T KSAIN+VVTR+YT+++HKRL+GV FKKRAPRAIKEI FA+K M T ++RVD LNK Sbjct: 4 TKKSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNKE 63 Query: 69 LWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIK 112 +W +G+RNVP +D++D A L+T V V VA+ K Sbjct: 64 VWKRGIRNVPHRLRLRLSRKRSDEDDKA--LYTYVQAVDVANPK 105 >SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Spt6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1365 Score = 24.6 bits (51), Expect = 4.6 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 14 INEVVTREYTVNLHKRLHGVGFKKRAPRAIKEI 46 INE VT +Y N+ + G+G ++A +K+I Sbjct: 860 INEAVTNKYEANILPYIAGLG-PRKADYVLKKI 891 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,020 Number of Sequences: 5004 Number of extensions: 16573 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 2 length of query: 124 length of database: 2,362,478 effective HSP length: 65 effective length of query: 59 effective length of database: 2,037,218 effective search space: 120195862 effective search space used: 120195862 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -