BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000955-TA|BGIBMGA000955-PA|undefined (90 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25383| Best HMM Match : Cyclin_N (HMM E-Value=0) 34 0.018 SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) 29 0.40 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 29 0.53 SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.69 SB_7181| Best HMM Match : C2 (HMM E-Value=1.2e-15) 28 0.92 SB_57981| Best HMM Match : Hemocyanin_M (HMM E-Value=8.5) 28 1.2 SB_56037| Best HMM Match : RepA_N (HMM E-Value=3.7) 28 1.2 SB_34947| Best HMM Match : Vps52 (HMM E-Value=0.0066) 28 1.2 SB_8609| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.2 SB_59343| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.6 SB_56651| Best HMM Match : DUF496 (HMM E-Value=8.5) 27 1.6 SB_58276| Best HMM Match : MIB_HERC2 (HMM E-Value=8.3e-33) 27 1.6 SB_39891| Best HMM Match : Seryl_tRNA_N (HMM E-Value=0.11) 27 1.6 SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.6 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.1 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.1 SB_4416| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.1 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.1 SB_39225| Best HMM Match : NIF (HMM E-Value=0) 27 2.8 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 27 2.8 SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.8 SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) 27 2.8 SB_41150| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.8 SB_53472| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.7 SB_29421| Best HMM Match : N_methyl (HMM E-Value=0.58) 26 3.7 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 26 3.7 SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.7 SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) 26 3.7 SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 26 3.7 SB_4328| Best HMM Match : Vicilin_N (HMM E-Value=0.39) 26 3.7 SB_16554| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_52409| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_49755| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1) 26 4.9 SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_22453| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_10475| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) 26 4.9 SB_614| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_57296| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.5 SB_56336| Best HMM Match : Ag332 (HMM E-Value=5.1) 25 6.5 SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.5 SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.5 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.5 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 25 8.6 SB_48343| Best HMM Match : CBF (HMM E-Value=1.3) 25 8.6 SB_47342| Best HMM Match : VWA (HMM E-Value=0) 25 8.6 SB_43947| Best HMM Match : efhand (HMM E-Value=2e-11) 25 8.6 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 25 8.6 SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) 25 8.6 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_11512| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) 25 8.6 SB_3031| Best HMM Match : NblA (HMM E-Value=8.4) 25 8.6 SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_50760| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 25 8.6 SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_36894| Best HMM Match : PXA (HMM E-Value=2.5e-13) 25 8.6 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 25 8.6 SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) 25 8.6 SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) 25 8.6 SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) 25 8.6 SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) 25 8.6 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 25 8.6 SB_16224| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 25 8.6 SB_10711| Best HMM Match : Brevenin (HMM E-Value=0.36) 25 8.6 >SB_25383| Best HMM Match : Cyclin_N (HMM E-Value=0) Length = 561 Score = 33.9 bits (74), Expect = 0.018 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 7/77 (9%) Query: 10 ACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNE-EEKEYIKTKFAVESLRKVMMDLNFT 68 A P PE+PAS E + E +E F D+ + + +Y K + E +++M L Sbjct: 97 ALPKPERPASKPEPMDMADFSEALNECFPTDVEDIDSGDYDKPQLCAEYAKEIMRFLR-- 154 Query: 69 VDGVAKEDKYSVVLTVL 85 A E+ YSV T + Sbjct: 155 ----AMEEHYSVSPTYM 167 >SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) Length = 1776 Score = 29.5 bits (63), Expect = 0.40 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Query: 15 EKPASSDENVQFPPLPEPTDE-------DFQDDLNEEEKEYIKTKFAVESLRKVMMD 64 ++P + +E + PPLP + E +D E+EKE++K +SL V +D Sbjct: 1668 QEPTAEEEEEKSPPLPPRSPELLAELESSSRDATREQEKEFVKDDDDDDSLTDVSLD 1724 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 29.1 bits (62), Expect = 0.53 Identities = 12/40 (30%), Positives = 23/40 (57%) Query: 10 ACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYI 49 A AP K + ++ Q PL + + DF + +E+EK+++ Sbjct: 516 ASKAPSKEVAPEKREQPQPLSQAIEVDFPLETSEQEKQFV 555 >SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 28.7 bits (61), Expect = 0.69 Identities = 18/60 (30%), Positives = 24/60 (40%) Query: 17 PASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKED 76 P D + +PP F DD E+E Y+ + FA L D N D A +D Sbjct: 495 PNFDDVPMNYPPKFYDEAPTFDDDPTEDEDIYVNSDFARAVLNDNAYDENAFYDNDAYDD 554 >SB_7181| Best HMM Match : C2 (HMM E-Value=1.2e-15) Length = 630 Score = 28.3 bits (60), Expect = 0.92 Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query: 21 DENVQFPPLPEPTDEDFQDDLNEEEKEYI--KTKFAVESLRKVMMD 64 D ++ P+P+D + +L +EE Y+ + +F E++R+V+ D Sbjct: 441 DVEMELCSCPDPSDLRYSIELCDEEMNYLIKRREFVYETMREVLGD 486 >SB_57981| Best HMM Match : Hemocyanin_M (HMM E-Value=8.5) Length = 292 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/43 (34%), Positives = 22/43 (51%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKED 76 D+D DD N+E +Y+ +A E V D F D +KE+ Sbjct: 24 DDDDDDDDNDENNDYVDDTYANEDDDDVANDDIFDKDLSSKEE 66 >SB_56037| Best HMM Match : RepA_N (HMM E-Value=3.7) Length = 200 Score = 27.9 bits (59), Expect = 1.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Query: 11 CPAPEKPASSDENVQFPPLPEPTDEDFQDD 40 C P+ + N++ PP+P P D++ +D Sbjct: 159 CRVPQTNEQDNGNIKSPPVPVPGDDEVTND 188 >SB_34947| Best HMM Match : Vps52 (HMM E-Value=0.0066) Length = 383 Score = 27.9 bits (59), Expect = 1.2 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 1 MSEIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLN 42 M+E++ EG P A+ D N E +EDFQ DLN Sbjct: 1 MAEVLDEEGPLDLPLNTATGDSNGS-QNGNEEQEEDFQVDLN 41 >SB_8609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 985 Score = 27.9 bits (59), Expect = 1.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Query: 11 CPAPEKPASSDENVQFPPLPEPTDEDFQDD 40 C P+ + N++ PP+P P D++ +D Sbjct: 921 CRVPQTNEQDNGNIKSPPVPVPGDDEVTND 950 >SB_59343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 864 Score = 27.5 bits (58), Expect = 1.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKE 75 D D ++NE +KE +TK V+ +K + + VD KE Sbjct: 199 DLDLSKEVNETKKEVQETKKDVQETKKEVHETKTKVDETKKE 240 >SB_56651| Best HMM Match : DUF496 (HMM E-Value=8.5) Length = 114 Score = 27.5 bits (58), Expect = 1.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKE 75 D D ++NE +KE +TK V+ K + ++ VD KE Sbjct: 70 DLDLSKEVNETKKEVKETKTKVDETNKEVHEVKGKVDETNKE 111 >SB_58276| Best HMM Match : MIB_HERC2 (HMM E-Value=8.3e-33) Length = 2822 Score = 27.5 bits (58), Expect = 1.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 29 LPEPTDEDFQDDLNEEEK 46 LPEP DED DD +E+E+ Sbjct: 1581 LPEPDDEDEDDDDDEDEE 1598 >SB_39891| Best HMM Match : Seryl_tRNA_N (HMM E-Value=0.11) Length = 285 Score = 27.5 bits (58), Expect = 1.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKE 75 D D ++NE +KE +TK V+ K + ++ VD KE Sbjct: 192 DLDLSKEVNETKKEVQETKTKVDEANKEVHEVKGKVDETNKE 233 >SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1268 Score = 27.5 bits (58), Expect = 1.6 Identities = 13/43 (30%), Positives = 19/43 (44%) Query: 12 PAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFA 54 PAP PA S + PL P E ++L E+ + +A Sbjct: 581 PAPTSPAPSGPEILKEPLNLPDTEQHDENLTEQTHHIVIPSYA 623 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 27.1 bits (57), Expect = 2.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKE 75 D D ++NE +KE +TK V+ +K + + VD KE Sbjct: 1286 DLDLSKEVNETKKEVQETKKDVQETKKEVDETKTKVDETKKE 1327 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 27.1 bits (57), Expect = 2.1 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 2 SEIIKSEGACP-APEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKE 47 SE + EGA P A K A + E P + DE+ DD EE +E Sbjct: 699 SEEDEEEGAKPSASAKIAKTSETENKVPKVDKDDEEDDDDEEEESEE 745 >SB_4416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 27.1 bits (57), Expect = 2.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 14 PEKPASSDENVQFPPLPEPTDEDFQDDLNEEEK 46 P++P+ DE + PP+P P++ N + K Sbjct: 96 PQQPSLLDEPIVTPPIPSPSESSSPKRPNRKTK 128 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 27.1 bits (57), Expect = 2.1 Identities = 10/31 (32%), Positives = 23/31 (74%) Query: 35 EDFQDDLNEEEKEYIKTKFAVESLRKVMMDL 65 + ++D+LNE++K+ K + +++L+K + DL Sbjct: 1620 QSYEDELNEKQKQKEKAEDNLKALKKRISDL 1650 >SB_39225| Best HMM Match : NIF (HMM E-Value=0) Length = 1772 Score = 26.6 bits (56), Expect = 2.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Query: 21 DENVQFPPLPEPTDEDFQDDLNEEEKEYI 49 +E Q P P E+F +L EEE+E I Sbjct: 310 EEETQRKKKPLPIQEEFSRELTEEERERI 338 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 26.6 bits (56), Expect = 2.8 Identities = 13/49 (26%), Positives = 24/49 (48%) Query: 12 PAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRK 60 P P K A + N F P+ EDF+ D+ +E + +++ L++ Sbjct: 847 PEPTKGAGEEGNEGFEFKPDGPKEDFEKDIMAVVREALPDATSLQELQE 895 >SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 26.6 bits (56), Expect = 2.8 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Query: 6 KSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTK-FAVESLRKVM 62 + + C P P S DE + P + TDE Q LN+ K + K A E L +V+ Sbjct: 100 RRQSVCAEPFHPDSEDEGDEQPIVYPKTDEQRQ-RLNDAIKNILLFKNLAKEQLNEVL 156 >SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) Length = 1552 Score = 26.6 bits (56), Expect = 2.8 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 12 PAPEKPASSDE-NVQFPPLPEPTDEDFQDDLNEEEKEY 48 P P P D + PP P P ++D ++L +E +E+ Sbjct: 1225 PRPPTPIEVDGIDSPSPPPPPPEEDDISEELVDEVQEF 1262 >SB_41150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 26.6 bits (56), Expect = 2.8 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Query: 14 PEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYI 49 P+K D+ P + +DED +D+L +EKE I Sbjct: 334 PKKKEEEDDEKSPPGIA--SDEDTEDELERQEKELI 367 >SB_53472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 26.2 bits (55), Expect = 3.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 22 ENVQFPPLPEPTDEDFQDDLNEEEKEYI 49 EN + P EP ED+ D+ EEE ++ Sbjct: 44 ENRERPGAEEPLAEDYYDEEEEEEGSHV 71 >SB_29421| Best HMM Match : N_methyl (HMM E-Value=0.58) Length = 534 Score = 26.2 bits (55), Expect = 3.7 Identities = 13/49 (26%), Positives = 23/49 (46%) Query: 39 DDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKEDKYSVVLTVLMF 87 D+L E +E K E ++ + FT G+A + ++T L+F Sbjct: 172 DELERENRELENRKPLRERIKAIFKKYGFTAIGLAVATTIAAIVTSLVF 220 >SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) Length = 1142 Score = 26.2 bits (55), Expect = 3.7 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 9 GACPAPEKPASSDENVQFPPLPEP 32 G P P+ P + +++ PP P+P Sbjct: 440 GGTPVPQPPPPAADSIPTPPQPQP 463 >SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 26.2 bits (55), Expect = 3.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKE 75 D D ++NE +KE +TK V+ +K + + VD +E Sbjct: 192 DLDLSKEVNETKKEVQETKKDVQETKKEVHETKTKVDETKRE 233 >SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) Length = 1092 Score = 26.2 bits (55), Expect = 3.7 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%) Query: 5 IKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLR-KVMM 63 +KS AC P+ P + + LP D+ F ++ Y T + ++ K Sbjct: 111 VKSSIACKLPDPPKGISDRLMTLRLPLSNDKRFATIIS----AYASTMTNPDEIKDKFYE 166 Query: 64 DLNFTVDGVAKEDKYSVV 81 DLN ++ V + DK ++ Sbjct: 167 DLNNVINTVPQADKLIIL 184 >SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 917 Score = 26.2 bits (55), Expect = 3.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Query: 7 SEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEK 46 SE P E+ A S N PP+ P +ED DD +EE + Sbjct: 557 SEEPSPYAEENAISRSN---PPVYTPKEEDDDDDDDEESE 593 >SB_4328| Best HMM Match : Vicilin_N (HMM E-Value=0.39) Length = 738 Score = 26.2 bits (55), Expect = 3.7 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Query: 23 NVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLN 66 N F EP+DED + L E+ E K++ +SL +DL+ Sbjct: 286 NTSFVYYDEPSDEDVTESLRVEDHE----KYSKKSLASYEIDLS 325 >SB_16554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 25.8 bits (54), Expect = 4.9 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%) Query: 5 IKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLR-KVMM 63 +KS AC P+ P + + LP D+ F ++ Y T + ++ K Sbjct: 30 VKSSIACKLPDPPKGISDRLMTLRLPLSNDKRFATIIS----AYAPTMTNPDEIKDKFYE 85 Query: 64 DLNFTVDGVAKEDKYSVV 81 DLN ++ V + DK ++ Sbjct: 86 DLNNVINTVPQADKLIIL 103 >SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1395 Score = 25.8 bits (54), Expect = 4.9 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%) Query: 5 IKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLR-KVMM 63 +KS AC P+ P + + LP D+ F ++ Y T + ++ K Sbjct: 151 VKSSIACKLPDPPKGISDRLMTLRLPLSNDKRFATIIS----AYAPTMTNPDEIKDKFYE 206 Query: 64 DLNFTVDGVAKEDKYSVV 81 DLN ++ V + DK ++ Sbjct: 207 DLNNVINTVPQADKLIIL 224 >SB_52409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 25.8 bits (54), Expect = 4.9 Identities = 10/33 (30%), Positives = 20/33 (60%) Query: 14 PEKPASSDENVQFPPLPEPTDEDFQDDLNEEEK 46 P++ A +EN + LP PT++D + + E++ Sbjct: 178 PQRLAVFEENFERFGLPYPTEQDLEREARREQR 210 >SB_49755| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1) Length = 192 Score = 25.8 bits (54), Expect = 4.9 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%) Query: 5 IKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLR-KVMM 63 +KS AC P+ P + + LP D+ F ++ Y T + ++ K Sbjct: 30 VKSSIACKLPDPPKGISDRLMTLRLPLSNDKRFATIIS----AYAPTMTNPDEIKDKFYE 85 Query: 64 DLNFTVDGVAKEDKYSVV 81 DLN ++ V + DK ++ Sbjct: 86 DLNNVINTVPQADKLIIL 103 >SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 25.8 bits (54), Expect = 4.9 Identities = 15/44 (34%), Positives = 23/44 (52%) Query: 41 LNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKEDKYSVVLTV 84 L E E+ + +AVE++ K ++ L DG K+ K VL V Sbjct: 155 LEEPEEVTLGDGYAVETIGKGVVKLELVADGETKKCKLHDVLYV 198 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 25.8 bits (54), Expect = 4.9 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 6/84 (7%) Query: 3 EIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKVM 62 +I K + PA +KP DE+V+ +P E EE+E K RKV Sbjct: 90 QIDKVRSSEPAAKKPCVEDESVEDAAQEQPPSE-----RQTEEEELPKHLDRSSDPRKVF 144 Query: 63 M-DLNFTVDGVAKEDKYSVVLTVL 85 + +L F++ DK+S T L Sbjct: 145 ISNLLFSITEDHLRDKFSKFPTSL 168 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 25.8 bits (54), Expect = 4.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Query: 35 EDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKEDK 77 EDF+ D E+E +K A+ S++K +F + V E K Sbjct: 125 EDFKGDDIEDELTQLKAVVALRSIQKGDSPKSFDLSSVCDEGK 167 >SB_22453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 25.8 bits (54), Expect = 4.9 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Query: 7 SEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYI-KTKFAVESLRKVMMDL 65 SE CP + S+ ++P E TD+D + +Y+ +T +E + KVMM L Sbjct: 55 SELRCPRSPRIELSEYFSEYPLFQEKTDKD------HVKGDYVFQTDHVIELVTKVMMQL 108 Query: 66 NFTVDGVA 73 + D +A Sbjct: 109 DAERDLLA 116 >SB_10475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 25.8 bits (54), Expect = 4.9 Identities = 15/47 (31%), Positives = 25/47 (53%) Query: 42 NEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKEDKYSVVLTVLMFF 88 NE+EKE IK + A ES + ++ L E Y ++L +++ F Sbjct: 2 NEKEKELIKLQEAHESQQILLQKLQGLYGTFIVEFGYRMILLMILSF 48 >SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1766 Score = 25.8 bits (54), Expect = 4.9 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%) Query: 5 IKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLR-KVMM 63 +KS AC P+ P + + LP D+ F ++ Y T + ++ K Sbjct: 105 VKSSIACKLPDPPKGISDRLMTLRLPLSNDKRFATIIS----AYAPTMTNPDEIKDKFYE 160 Query: 64 DLNFTVDGVAKEDKYSVV 81 DLN ++ V + DK ++ Sbjct: 161 DLNNVINTVPQADKLIIL 178 >SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) Length = 1017 Score = 25.8 bits (54), Expect = 4.9 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Query: 7 SEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYI-KTKFAVESLRKVMMDL 65 SE CP + S+ ++P E TD+D + +Y+ +T +E + KVMM L Sbjct: 949 SELRCPRSPRIELSEYFSEYPLFQEKTDKD------HVKGDYVFQTDHVIELVTKVMMQL 1002 Query: 66 NFTVDGVA 73 + D +A Sbjct: 1003 DAERDLLA 1010 >SB_614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 25.8 bits (54), Expect = 4.9 Identities = 12/42 (28%), Positives = 20/42 (47%) Query: 3 EIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEE 44 E +K E E D N F P+ +PT++D + + E+ Sbjct: 350 EPVKPEEQEEPEELEEQGDSNSVFVPMVDPTEQDCRQEQEEQ 391 >SB_57296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 25.4 bits (53), Expect = 6.5 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Query: 7 SEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAV 55 SEG+ PA ++P D QFP PE D++ D + E+ +T V Sbjct: 123 SEGS-PA-KRPKLPDMEAQFPSPPEAGDDNVFYDSDVPRSEHGRTNQGV 169 >SB_56336| Best HMM Match : Ag332 (HMM E-Value=5.1) Length = 366 Score = 25.4 bits (53), Expect = 6.5 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 5/71 (7%) Query: 12 PAPEKPASSDENVQFPPLPEPTDED--FQDDLNEEEKE---YIKTKFAVESLRKVMMDLN 66 P E+P + + P L EP +E+ ++ + EE K+ + + K AV KV + Sbjct: 110 PVKEEPKQEGQVEEEPKLEEPVEEEPKQEEPVEEEPKQEEPFEEQKEAVAEESKVDAPVA 169 Query: 67 FTVDGVAKEDK 77 GV ++ K Sbjct: 170 IDTSGVYEKPK 180 >SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 25.4 bits (53), Expect = 6.5 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 14 PEKPASSDENVQFPPLPEP-TDEDFQDDLNEEEKEYIK 50 P KPA++ E V P P+P T + + + E K+ K Sbjct: 137 PPKPAAAKEPVPVKPEPKPETKPEAKQEAKPEAKQVTK 174 >SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2011 Score = 25.4 bits (53), Expect = 6.5 Identities = 12/46 (26%), Positives = 24/46 (52%) Query: 27 PPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGV 72 P E T + D EE+++ + ++AV+ + M +L F +D + Sbjct: 1588 PKTREETVFNEDSDEEEEDQKIVPVEYAVDEVETQMEELLFRMDNL 1633 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 25.4 bits (53), Expect = 6.5 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Query: 16 KPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKVMMDL 65 KP + +Q P PE +E Q+ LNE + K K + + ++D+ Sbjct: 76 KPPEERDPIQ-PRTPEHMEEQLQNFLNEGNGDLKKAKDYFNVIHEPLLDI 124 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 25.0 bits (52), Expect = 8.6 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Query: 20 SDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRK 60 SDEN+ PP PE D+N + IK + V RK Sbjct: 395 SDENIPLPPRPELA------DVNSDSASTIKCTYDVWQRRK 429 >SB_48343| Best HMM Match : CBF (HMM E-Value=1.3) Length = 669 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/27 (33%), Positives = 19/27 (70%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLRK 60 D+D +DD +++++++ K+ A LRK Sbjct: 180 DDDDEDDDDDDDEDFYKSDLARTGLRK 206 >SB_47342| Best HMM Match : VWA (HMM E-Value=0) Length = 483 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 7 SEGACPAPEKPASSDENVQFPPLPEPT 33 S+ ACPAP +P+ +D V P T Sbjct: 227 SKRACPAPIQPSPTDSQVTRENSPSTT 253 >SB_43947| Best HMM Match : efhand (HMM E-Value=2e-11) Length = 482 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/51 (25%), Positives = 21/51 (41%) Query: 27 PPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKEDK 77 PP DD + + KTK +V+ L K ++ +D KE + Sbjct: 254 PPSMRGCSPSGSDDSKNLQSDLEKTKLSVQELEKQRLEAQSKLDDFDKEQQ 304 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 40 DLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKEDKY 78 +LN ++EY K +E L + DL D +E KY Sbjct: 125 ELNALQEEYESQKIKIEELEVRIEDLKEENDDYQQETKY 163 >SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) Length = 631 Score = 25.0 bits (52), Expect = 8.6 Identities = 16/49 (32%), Positives = 21/49 (42%) Query: 2 SEIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIK 50 SEI EG+ E DE P DED DD + +E E ++ Sbjct: 178 SEIEDQEGSESMDEDQGDEDEVEDEVPEEGDNDEDGDDDNDYDEDENLE 226 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 25.0 bits (52), Expect = 8.6 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Query: 27 PPLPEPTDEDFQD--DLNEEEKEYIKTKFAVESLRK 60 PP+PE +DE+ +D D ++ EK I+ +R+ Sbjct: 283 PPIPESSDEEEEDMKDDSKTEKTEIQASHPTALIRR 318 >SB_11512| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) Length = 639 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/29 (31%), Positives = 14/29 (48%) Query: 12 PAPEKPASSDENVQFPPLPEPTDEDFQDD 40 P P +P +++ PP P+P D D Sbjct: 581 PRPARPQPEPRHLRSPPEPKPRHRDSSHD 609 >SB_3031| Best HMM Match : NblA (HMM E-Value=8.4) Length = 256 Score = 25.0 bits (52), Expect = 8.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 29 LPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKVMMDLN 66 LP T+ D DL E + + + + E+ R +M DL+ Sbjct: 46 LPRETERDLVRDLTRETERDLVRELSRETERDLMRDLS 83 >SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 25.0 bits (52), Expect = 8.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Query: 18 ASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVE 56 A+SD N P + + TD+ QDD +EE + + K A E Sbjct: 714 ATSDANGLPPMVHQRTDDLTQDDKKKEETDGKEDKGAKE 752 >SB_50760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 36 DFQDDLNEEEKEYIKTKFAVESLRKV 61 DFQD +EE + KT+ + L+KV Sbjct: 51 DFQDRSSEERIGFTKTRTSFRDLKKV 76 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 34 DEDFQDDLNEEEKEYIKTKFAVESLR 59 +EDF+ LNE E E K + A+E ++ Sbjct: 238 EEDFKAQLNELEVEKAKEQTALEEMK 263 >SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/44 (31%), Positives = 18/44 (40%) Query: 2 SEIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEE 45 S IK E + P KP ++ P PEP +E E E Sbjct: 528 SSEIKPEASKPETAKPEATSPTDGEPAKPEPAEESSAKPSEEAE 571 >SB_36894| Best HMM Match : PXA (HMM E-Value=2.5e-13) Length = 1252 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/72 (19%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Query: 2 SEIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQ---DDLNEEEKEYIKTKFAVESL 58 S++ S +C + ++ A+ ++ P + D+ ++ D + E + + ++ A + Sbjct: 1159 SDLGSSLASCKSDDEDANYRASLHLPFSKKNLDQKWKSASDKMKERKSKSVENVAAAKDK 1218 Query: 59 RKVMMDLNFTVD 70 K +NFT+D Sbjct: 1219 MKAFKGVNFTMD 1230 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/49 (26%), Positives = 22/49 (44%) Query: 12 PAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRK 60 P + P+S++ + P D+ +L EE+KE K + E K Sbjct: 104 PTKKDPSSTENHSLLEEKDIPRDKKSDKELKEEKKEKEKERMKKEEKHK 152 >SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) Length = 350 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 17 PASSDENVQFPPLPEPTDEDFQDDLNEEEKE 47 PA+++E + E DE Q+D EE++E Sbjct: 21 PATTEEELSPAAQDETKDEPLQEDDGEEDEE 51 >SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) Length = 2658 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/29 (31%), Positives = 14/29 (48%) Query: 12 PAPEKPASSDENVQFPPLPEPTDEDFQDD 40 P P +P +++ PP P+P D D Sbjct: 2600 PRPARPQPEPRHLRSPPEPKPRHRDSSHD 2628 >SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) Length = 356 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Query: 8 EGACPAPEKPASSDENVQFPPLPEPTDEDFQDD----LNEEEKEYIK 50 +G P P S + + P +P D+ + DD +NEE ++ +K Sbjct: 154 DGHKPQAPNPTQSRDRSRERPRDQPRDDKYYDDMIVRINEELEQAVK 200 >SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) Length = 2261 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 15 EKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIKTKFAVESLRKV 61 + P S + PP P P D + + + E++K I+ K E L V Sbjct: 1726 KSPGKSSMKAETPPPPPPEDAEGESE-EEKQKILIREKARKEFLGAV 1771 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 25.0 bits (52), Expect = 8.6 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query: 8 EGACPAPEKPASSDENVQF--PPLPEPTDEDFQDDLNEEEKEYIKTKFAVES 57 + A PAP+ ++S V P+ EP ED Q++ + E + +T VES Sbjct: 1068 DDAPPAPQDESTSSRAVPRIEEPVNEPEVEDPQEEADTETETEPETAEEVES 1119 >SB_16224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1127 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/49 (26%), Positives = 22/49 (44%) Query: 2 SEIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIK 50 + + K+ G E P S E Q P P+D+ + + +E K +K Sbjct: 540 NRMTKTSGTRKQKEAPGSEAEPSQKESTPMPSDDTIESNQHEITKSPLK 588 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 40 DLNEEEKEYIKTKFAVESLRKVMMDLNFTVDGVAKEDKY 78 +LN ++EY K +E L + DL D +E KY Sbjct: 862 ELNALQEEYESQKIKIEELEVRIEDLKEENDDYQQETKY 900 >SB_10711| Best HMM Match : Brevenin (HMM E-Value=0.36) Length = 65 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 17 PASSDENVQFPPLPEPTDEDFQDDLNEEEKE 47 PA+++E + E DE Q+D EE++E Sbjct: 21 PATTEEELSPAAQDETKDEPLQEDDGEEDEE 51 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.132 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,108,904 Number of Sequences: 59808 Number of extensions: 129643 Number of successful extensions: 671 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 26 Number of HSP's that attempted gapping in prelim test: 613 Number of HSP's gapped (non-prelim): 87 length of query: 90 length of database: 16,821,457 effective HSP length: 67 effective length of query: 23 effective length of database: 12,814,321 effective search space: 294729383 effective search space used: 294729383 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -