BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000954-TA|BGIBMGA000954-PA|undefined (86 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39808| Best HMM Match : EGF_CA (HMM E-Value=6.3e-35) 26 3.8 SB_56570| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.7 SB_59662| Best HMM Match : efhand (HMM E-Value=2.2) 25 8.7 >SB_39808| Best HMM Match : EGF_CA (HMM E-Value=6.3e-35) Length = 850 Score = 26.2 bits (55), Expect = 3.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Query: 56 GTVSPLITWGRTLNTDLPRPDNDRY 80 G +P I W N D P P +DRY Sbjct: 179 GHPAPHIAWAIGANGDAPLPTDDRY 203 >SB_56570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 45 IKNAVRAAPVVGTVSPLITWGRT 67 +KN V PV+ T+ P +W +T Sbjct: 318 VKNIVYGKPVIQTLKPQSSWKKT 340 >SB_59662| Best HMM Match : efhand (HMM E-Value=2.2) Length = 318 Score = 25.0 bits (52), Expect = 8.7 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 40 PSWAIIKNAVRA-APVVGTVSPLITWGRTLNTDLPRPDND 78 P W ++N V+ +SPLI R L+ +PD D Sbjct: 98 PQWRELRNISSPHKEVIRRISPLINPSRYLSVSKVQPDQD 137 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.133 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,805,049 Number of Sequences: 59808 Number of extensions: 80440 Number of successful extensions: 139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 137 Number of HSP's gapped (non-prelim): 3 length of query: 86 length of database: 16,821,457 effective HSP length: 63 effective length of query: 23 effective length of database: 13,053,553 effective search space: 300231719 effective search space used: 300231719 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -