SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000954-TA|BGIBMGA000954-PA|undefined
         (86 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g20240.1 68415.m02365 expressed protein                             25   6.2  

>At2g20240.1 68415.m02365 expressed protein 
          Length = 713

 Score = 25.0 bits (52), Expect = 6.2
 Identities = 11/43 (25%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 47  NAVRAAPVVGTVSPLITWGRTLNTDLPRP------DNDRYAYV 83
           N +  +P +GT++ ++ W     TD  +P      D D Y ++
Sbjct: 539 NLIDKSPPIGTIARILAWEDESYTDTSKPAMGIEEDEDWYGFI 581


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.316    0.133    0.423 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,909,428
Number of Sequences: 28952
Number of extensions: 54207
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 53
Number of HSP's gapped (non-prelim): 1
length of query: 86
length of database: 12,070,560
effective HSP length: 65
effective length of query: 21
effective length of database: 10,188,680
effective search space: 213962280
effective search space used: 213962280
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -