BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000954-TA|BGIBMGA000954-PA|undefined (86 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20240.1 68415.m02365 expressed protein 25 6.2 >At2g20240.1 68415.m02365 expressed protein Length = 713 Score = 25.0 bits (52), Expect = 6.2 Identities = 11/43 (25%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Query: 47 NAVRAAPVVGTVSPLITWGRTLNTDLPRP------DNDRYAYV 83 N + +P +GT++ ++ W TD +P D D Y ++ Sbjct: 539 NLIDKSPPIGTIARILAWEDESYTDTSKPAMGIEEDEDWYGFI 581 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.133 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,909,428 Number of Sequences: 28952 Number of extensions: 54207 Number of successful extensions: 54 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 53 Number of HSP's gapped (non-prelim): 1 length of query: 86 length of database: 12,070,560 effective HSP length: 65 effective length of query: 21 effective length of database: 10,188,680 effective search space: 213962280 effective search space used: 213962280 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -