BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000953-TA|BGIBMGA000953-PA|undefined (59 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31G5.19 |||ATPase with bromodomain protein|Schizosaccharomyc... 23 3.6 SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosacc... 23 6.4 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 22 8.4 >SPAC31G5.19 |||ATPase with bromodomain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1190 Score = 23.4 bits (48), Expect = 3.6 Identities = 10/39 (25%), Positives = 18/39 (46%) Query: 3 VSNAIQLTVFMVAVLWKNEAEAATKASVKFCGRHLSEIM 41 V + L F+ ++W ++E + V C R + E M Sbjct: 1147 VDQLLHLHSFLYQIIWNTKSEWNRNSVVDECERAVKEFM 1185 >SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 451 Score = 22.6 bits (46), Expect = 6.4 Identities = 10/24 (41%), Positives = 11/24 (45%) Query: 35 RHLSEIMSRVCHAYNGPAWDVPTG 58 R S+ R Y GP DVP G Sbjct: 129 RRFSQAFMRQLFRYIGPQTDVPAG 152 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 22.2 bits (45), Expect = 8.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 37 LSEIMSRVCHAYN 49 LS+++SRVCH N Sbjct: 1900 LSQMISRVCHPNN 1912 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.323 0.131 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,541 Number of Sequences: 5004 Number of extensions: 5073 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 3 length of query: 59 length of database: 2,362,478 effective HSP length: 40 effective length of query: 19 effective length of database: 2,162,318 effective search space: 41084042 effective search space used: 41084042 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -