BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000953-TA|BGIBMGA000953-PA|undefined (59 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50799| Best HMM Match : I-set (HMM E-Value=0) 26 3.8 SB_57545| Best HMM Match : zf-C3HC4 (HMM E-Value=0.023) 26 5.1 >SB_50799| Best HMM Match : I-set (HMM E-Value=0) Length = 1195 Score = 26.2 bits (55), Expect = 3.8 Identities = 14/44 (31%), Positives = 22/44 (50%) Query: 1 MLVSNAIQLTVFMVAVLWKNEAEAATKASVKFCGRHLSEIMSRV 44 +++ I LT + AV WK + + T A++ R L SRV Sbjct: 169 VILEQTINLTCVVRAVYWKKDGQIITTATLSGNNRTLITQASRV 212 >SB_57545| Best HMM Match : zf-C3HC4 (HMM E-Value=0.023) Length = 601 Score = 25.8 bits (54), Expect = 5.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 33 CGRHLSEIMSRVCHAYNG 50 C HL+E ++ +C A+NG Sbjct: 286 CSPHLAEKIAEICSAFNG 303 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.323 0.131 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,704,569 Number of Sequences: 59808 Number of extensions: 38111 Number of successful extensions: 177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 175 Number of HSP's gapped (non-prelim): 2 length of query: 59 length of database: 16,821,457 effective HSP length: 38 effective length of query: 21 effective length of database: 14,548,753 effective search space: 305523813 effective search space used: 305523813 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -