BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000950-TA|BGIBMGA000950-PA|undefined (1347 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 25 4.6 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 24 6.1 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 24 6.1 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 24 6.1 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 24.6 bits (51), Expect = 4.6 Identities = 17/61 (27%), Positives = 26/61 (42%) Query: 147 FYTKFIKIKTKLYYKQRKFNLFREESEGYSKLIVELNQEINEDTEWKNLLEIIQSLIGCF 206 F K+ I L + + F ++ EG I ELN NE W ++ I+ S + Sbjct: 169 FRGKYRNINLLLTEQLQNRRFFAKKMEGLVCSIKELNMIFNEFFGWPIIMIILYSSLMVL 228 Query: 207 N 207 N Sbjct: 229 N 229 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 24.2 bits (50), Expect = 6.1 Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 1298 EQKGAIKMSGHQNGSQEDHHYDKFKREKSPFR 1329 EQ G HQ+GS HH+++ + +R Sbjct: 6 EQSGFYGSHHHQSGSVAGHHHEQSAAAAAAYR 37 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 24.2 bits (50), Expect = 6.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 854 SSIQPMLPARVLEDISPEFYVTFWS 878 + + P L A LE+IS + +V FW+ Sbjct: 433 TKLSPELKAGSLEEISVKRFVKFWT 457 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 24.2 bits (50), Expect = 6.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 854 SSIQPMLPARVLEDISPEFYVTFWS 878 + + P L A LE+IS + +V FW+ Sbjct: 435 TKLSPELKAGSLEEISVKRFVKFWT 459 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 279,867 Number of Sequences: 317 Number of extensions: 11336 Number of successful extensions: 38 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 34 Number of HSP's gapped (non-prelim): 4 length of query: 1347 length of database: 114,650 effective HSP length: 65 effective length of query: 1282 effective length of database: 94,045 effective search space: 120565690 effective search space used: 120565690 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -