Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000949-TA|BGIBMGA000949-PA|undefined
         (354 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            25   2.4  
AY578797-1|AAT07302.1|  304|Anopheles gambiae activin protein.         24   7.3  

>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 25.4 bits (53), Expect = 2.4
 Identities = 15/47 (31%), Positives = 22/47 (46%)

Query: 180  NANLHLAVGRNDGSVQLYLIDVENLHLKPRLKFTYMSGATREGWQEV 226
            N +   A+GR+ G VQ Y ID    H K    F+      +EG  ++
Sbjct: 2443 NNHFMTALGRSAGDVQSYEIDANGNHRKFYTGFSRYRLEYQEGTNKI 2489


>AY578797-1|AAT07302.1|  304|Anopheles gambiae activin protein.
          Length = 304

 Score = 23.8 bits (49), Expect = 7.3
 Identities = 7/11 (63%), Positives = 11/11 (100%)

Query: 222 GWQEVDITSAV 232
           GWQ++D+T+AV
Sbjct: 48  GWQQIDLTNAV 58


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.321    0.136    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 356,237
Number of Sequences: 2123
Number of extensions: 14133
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 3
length of query: 354
length of database: 516,269
effective HSP length: 65
effective length of query: 289
effective length of database: 378,274
effective search space: 109321186
effective search space used: 109321186
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 48 (23.4 bits)