BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000949-TA|BGIBMGA000949-PA|undefined (354 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 26 0.43 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 26.2 bits (55), Expect = 0.43 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 159 SNCLVEGRGLGSVVCLGWFYSNANLHLAVGRNDGSVQLYL 198 S L +GR G +V +G NAN+ + G DG + +++ Sbjct: 450 SGNLEKGRCTGKIVTVG-SDGNANIEIGAGEEDGVLAIHV 488 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,299 Number of Sequences: 429 Number of extensions: 3774 Number of successful extensions: 8 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 1 length of query: 354 length of database: 140,377 effective HSP length: 58 effective length of query: 296 effective length of database: 115,495 effective search space: 34186520 effective search space used: 34186520 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -