GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000949-TA|BGIBMGA000949-PA|undefined
         (354 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.            26   0.43 

>AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.
          Length = 493

 Score = 26.2 bits (55), Expect = 0.43
 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 159 SNCLVEGRGLGSVVCLGWFYSNANLHLAVGRNDGSVQLYL 198
           S  L +GR  G +V +G    NAN+ +  G  DG + +++
Sbjct: 450 SGNLEKGRCTGKIVTVG-SDGNANIEIGAGEEDGVLAIHV 488


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.136    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,299
Number of Sequences: 429
Number of extensions: 3774
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 354
length of database: 140,377
effective HSP length: 58
effective length of query: 296
effective length of database: 115,495
effective search space: 34186520
effective search space used: 34186520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)