BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000948-TA|BGIBMGA000948-PA|IPR004939|Anaphase-promoting complex subunit 10, IPR000437|Prokaryotic membrane lipoprotein lipid attachment site, IPR008979|Galactose-binding like (182 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 0.76 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 3.1 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 24.2 bits (50), Expect = 0.76 Identities = 10/43 (23%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 36 GIDQLRDDCMETYWQS-DGQLPHLVNIQFQKKTMVSHIYIYTD 77 G ++ ++ +E W +N++ +KK +SH ++YT+ Sbjct: 425 GFSKIAENLLEKNWLPVHTSYKSGLNLEQEKKDSISHYHLYTN 467 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 31 CKPGFGIDQLRDDCME 46 CKPG+ D + +C E Sbjct: 249 CKPGYQADVEKQECTE 264 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.136 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,512 Number of Sequences: 429 Number of extensions: 2196 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 182 length of database: 140,377 effective HSP length: 54 effective length of query: 128 effective length of database: 117,211 effective search space: 15003008 effective search space used: 15003008 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -