BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000948-TA|BGIBMGA000948-PA|IPR004939|Anaphase-promoting complex subunit 10, IPR000437|Prokaryotic membrane lipoprotein lipid attachment site, IPR008979|Galactose-binding like (182 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.28 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 23 2.0 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 4.5 AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 21 6.0 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 21 6.0 AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochr... 21 6.0 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.4 bits (53), Expect = 0.28 Identities = 18/62 (29%), Positives = 24/62 (38%), Gaps = 5/62 (8%) Query: 21 GNHAIWSLSSCKPGFGIDQLRDDCMETYWQSDGQLPHLVNI-----QFQKKTMVSHIYIY 75 GN W+ K G + R D + TYW + Q I + TM+SH Y Sbjct: 190 GNAKHWTGIFQKKWRGYEDFRRDFLRTYWSAKRQRDIRFQIATGRYDETRGTMLSHFAYY 249 Query: 76 TD 77 D Sbjct: 250 VD 251 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 22.6 bits (46), Expect = 2.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 78 YKLDESYTPSRISIRAGTH 96 Y LDE PS+I++ GT+ Sbjct: 246 YWLDEGAPPSKINLGLGTY 264 Score = 20.6 bits (41), Expect = 7.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Query: 48 YWQSDGQLPHLV 59 +W + Q+PH+V Sbjct: 313 FWDDEQQVPHIV 324 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Query: 159 PTSFDINKFRNFSTVQF 175 PT DIN F + T QF Sbjct: 34 PTPTDINSFYFYKTEQF 50 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 78 YKLDESYTPSRISIRAGTH 96 Y LDE PS+I++ G++ Sbjct: 247 YWLDEGAPPSKINLGLGSY 265 Score = 20.6 bits (41), Expect = 7.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Query: 48 YWQSDGQLPHLV 59 +W + Q+PH+V Sbjct: 314 FWDDEQQVPHIV 325 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 78 YKLDESYTPSRISIRAGTH 96 Y LDE PS+I++ G++ Sbjct: 247 YWLDEGAPPSKINLGLGSY 265 Score = 20.6 bits (41), Expect = 7.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Query: 48 YWQSDGQLPHLV 59 +W + Q+PH+V Sbjct: 314 FWDDEQQVPHIV 325 >AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 63 Score = 21.0 bits (42), Expect = 6.0 Identities = 7/23 (30%), Positives = 15/23 (65%) Query: 97 FNDLQEIEVIELIEPSGWEMIPV 119 ++DLQE++ +EL+ + P+ Sbjct: 40 YSDLQEMKYLELVIKEALRLYPL 62 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.136 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,886 Number of Sequences: 317 Number of extensions: 1839 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 182 length of database: 114,650 effective HSP length: 53 effective length of query: 129 effective length of database: 97,849 effective search space: 12622521 effective search space used: 12622521 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -