BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000945-TA|BGIBMGA000945-PA|undefined (123 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20060.1 68417.m02935 expressed protein ; expression support... 26 8.3 >At4g20060.1 68417.m02935 expressed protein ; expression supported by MPSS Length = 1134 Score = 25.8 bits (54), Expect = 8.3 Identities = 15/48 (31%), Positives = 22/48 (45%) Query: 14 LGLCSALSGSTNVAKRLAVIVYPGNIRRVTGHARAECATSIRFQLITG 61 + L S ST++A LA ++ P T HARA + F + G Sbjct: 257 VSLTKLASRSTHLASELAEVIIPFLGEDKTSHARAAVLRCLHFLIERG 304 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.323 0.134 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,740,541 Number of Sequences: 28952 Number of extensions: 93016 Number of successful extensions: 149 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 148 Number of HSP's gapped (non-prelim): 1 length of query: 123 length of database: 12,070,560 effective HSP length: 73 effective length of query: 50 effective length of database: 9,957,064 effective search space: 497853200 effective search space used: 497853200 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -